prot_L-elsbetiae_contig68.15558.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig68.15558.1 vs. uniprot
Match: A0A6H5JKL9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKL9_9PHAE) HSP 1 Score: 85.1 bits (209), Expect = 1.190e-16 Identity = 59/121 (48.76%), Postives = 69/121 (57.02%), Query Frame = 0 Query: 32 DAAGAGA-----AQSPAADLCDDELCVVSLGLHDLEVFVARPSAADFGAPSFESPQPAPLGAES-------------ETQPS-----PASENGCCLQAGLSNAEGLVLPFSVDFSHVLTAR 129 DAAGA A A + AA+ ELCV+SLGL L+VFVARPS +DFG PS + P+P E E QP+ PA G CL+ GLSN EGLVLPF VDF HV+ AR Sbjct: 2001 DAAGAAAGVXXAADTDAAETTAAELCVMSLGLEGLQVFVARPSMSDFG-PSQQESSPSPTQPEEAVPAGLRGADDGQERQPTAPAPAPAGTTGRCLRGGLSNGEGLVLPFRVDFKHVILAR 2120 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig68.15558.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig68.15558.1 ID=prot_L-elsbetiae_contig68.15558.1|Name=mRNA_L-elsbetiae_contig68.15558.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=130bpback to top |