prot_L-elsbetiae_contig675.15497.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig675.15497.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 9.020e-6 Identity = 22/35 (62.86%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 8 RCGHPSCFKAPSYGVSGSNKREFCAQHAKEGIVHV 42 +CGH +C K P+YGV+GS KREFC+QHA++G+V+V Sbjct: 3 QCGHANCTKRPTYGVAGSKKREFCSQHARDGMVNV 37
BLAST of mRNA_L-elsbetiae_contig675.15497.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 1.180e-5 Identity = 22/35 (62.86%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 8 RCGHPSCFKAPSYGVSGSNKREFCAQHAKEGIVHV 42 +CGH +C K P+YGV+GS KREFC+QHA++G+V+V Sbjct: 63 QCGHENCTKRPTYGVAGSKKREFCSQHARDGMVNV 97 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig675.15497.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig675.15497.1 ID=prot_L-elsbetiae_contig675.15497.1|Name=mRNA_L-elsbetiae_contig675.15497.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=372bpback to top |