prot_L-elsbetiae_contig6735.15479.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6735.15479.1 vs. uniprot
Match: D7FLJ4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLJ4_ECTSI) HSP 1 Score: 61.6 bits (148), Expect = 1.770e-6 Identity = 29/47 (61.70%), Postives = 37/47 (78.72%), Query Frame = 0 Query: 99 RLANYQRVESIDWAAVDVSMRHVVSWPRRVQRLSFVEEFNQDLRCVL 145 RLA YQRV + WAA+ VS++ +VSWP V+RL+F+E FNQDLR VL Sbjct: 17 RLARYQRVLHVVWAALGVSIQRIVSWPGGVRRLTFLEGFNQDLRWVL 63
BLAST of mRNA_L-elsbetiae_contig6735.15479.1 vs. uniprot
Match: A0A6H5JK24_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK24_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 1.960e-5 Identity = 27/47 (57.45%), Postives = 36/47 (76.60%), Query Frame = 0 Query: 99 RLANYQRVESIDWAAVDVSMRHVVSWPRRVQRLSFVEEFNQDLRCVL 145 RLA YQRV + WAA+ VS++ +VSWP RL+F+E+F+QDLR VL Sbjct: 17 RLARYQRVLHVVWAALGVSIQRIVSWPGGEGRLTFLEDFDQDLRWVL 63 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6735.15479.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6735.15479.1 ID=prot_L-elsbetiae_contig6735.15479.1|Name=mRNA_L-elsbetiae_contig6735.15479.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=519bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|