prot_L-elsbetiae_contig6411.15090.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6411.15090.1 vs. uniprot
Match: D7G0B6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0B6_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 1.950e-8 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 1 MSFLDGLCDLPE-DIEISWRSFLHLEDVCSLTTLGAFASGLLALLTLAAVL 50 M FLDGLCD P+ + + SW F L++VCSLTTLGA +GL+ALL+ A+L Sbjct: 1 MGFLDGLCDSPDGEAKFSWHDFWRLDNVCSLTTLGAVVAGLVALLSFVAML 51
BLAST of mRNA_L-elsbetiae_contig6411.15090.1 vs. uniprot
Match: A0A6H5JJ25_9PHAE (ABC protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ25_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 2.670e-8 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 1 MSFLDGLCDLPE-DIEISWRSFLHLEDVCSLTTLGAFASGLLALLTLAAVL 50 M FLDGLCD P+ + E SW F L++VCSLTTLGA +GL+AL++ A+L Sbjct: 1 MGFLDGLCDSPDGEAEFSWHDFWLLDNVCSLTTLGAVVAGLVALMSFVAML 51 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6411.15090.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6411.15090.1 ID=prot_L-elsbetiae_contig6411.15090.1|Name=mRNA_L-elsbetiae_contig6411.15090.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=50bpback to top |