prot_L-elsbetiae_contig6405.15082.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6405.15082.1 vs. uniprot
Match: A0A2J6R851_9HELO (WSC-domain-containing protein n=1 Tax=Hyaloscypha variabilis F TaxID=1149755 RepID=A0A2J6R851_9HELO) HSP 1 Score: 54.7 bits (130), Expect = 6.290e-6 Identity = 30/76 (39.47%), Postives = 41/76 (53.95%), Query Frame = 0 Query: 1 MTPTACIESCGAEGKFLFPAVAMGGICECVELDEINLSEVDAGATCDVPCRGDETLTCGGSEAYGVYIQRSLQNAV 76 +T T C+ CGA G F GG C C +E+ S A ++CD+PC GD T TCGGS A VY + + ++ Sbjct: 515 VTNTKCVAYCGAAG-FSMAGTEYGGQCFCG--NELEGSSKLAESSCDMPCEGDGTQTCGGSLALSVYTSATKKRSI 587
BLAST of mRNA_L-elsbetiae_contig6405.15082.1 vs. uniprot
Match: A0A1L7WZA8_9HELO (Related to glyoxal oxidase n=1 Tax=Phialocephala subalpina TaxID=576137 RepID=A0A1L7WZA8_9HELO) HSP 1 Score: 54.3 bits (129), Expect = 8.620e-6 Identity = 29/71 (40.85%), Postives = 37/71 (52.11%), Query Frame = 0 Query: 1 MTPTACIESCGAEGKFLFPAVAMGGICECVELDEINLSEVDAGATCDVPCRGDETLTCGGSEAYGVYIQRS 71 +T T C++ C A G F GG C C DE++ S +CD+PC GD T TCGG A VY + S Sbjct: 534 VTNTKCVDYCSARG-FSMAGTEYGGQCFCG--DELSGSSALTETSCDMPCEGDGTQTCGGGLALSVYTKNS 601
BLAST of mRNA_L-elsbetiae_contig6405.15082.1 vs. uniprot
Match: A0A409W0R8_9AGAR (Uncharacterized protein n=1 Tax=Gymnopilus dilepis TaxID=231916 RepID=A0A409W0R8_9AGAR) HSP 1 Score: 52.8 bits (125), Expect = 2.620e-5 Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 0 Query: 1 MTPTACIESCGAEG---KFLFPAVAMGGICECVELDEINLSEVDAGATCDVPCRGDETLTCGGSEAYGVYIQRSLQNAVSIAAAAD 83 MTP CIE CG + ++ F V C C + +I + D + C++PC+GD +LTCGGS V+ + ++ AAA + Sbjct: 67 MTPALCIELCGPDNFYPQYGFAGVEYSQECFCDGIIQITGNLTDP-SECNLPCKGDRSLTCGGSNHISVFTNGTPSPKITTAAAVN 151
BLAST of mRNA_L-elsbetiae_contig6405.15082.1 vs. uniprot
Match: UPI002007DFD4 (WSC domain-containing protein n=1 Tax=Xylaria bambusicola TaxID=326684 RepID=UPI002007DFD4) HSP 1 Score: 52.0 bits (123), Expect = 5.390e-5 Identity = 25/74 (33.78%), Postives = 38/74 (51.35%), Query Frame = 0 Query: 1 MTPTACIESCGAEGKFLFPAVAMGGICECVELDEINLSEVDAGATCDVPCRGDETLTCGGSEAYGVYIQRSLQN 74 MT C++SC +G F F GG C C + + +TC++PC GD + TCGG +Y+ + LQ+ Sbjct: 171 MTNDKCLKSC-LDGGFPFAGTEYGGECYCGVVIGNGTALATDESTCNMPCNGDSSQTCGGPARLSLYVAKDLQS 243
BLAST of mRNA_L-elsbetiae_contig6405.15082.1 vs. uniprot
Match: A0A067SDK4_GALM3 (Uncharacterized protein n=1 Tax=Galerina marginata (strain CBS 339.88) TaxID=685588 RepID=A0A067SDK4_GALM3) HSP 1 Score: 51.6 bits (122), Expect = 7.060e-5 Identity = 28/89 (31.46%), Postives = 43/89 (48.31%), Query Frame = 0 Query: 1 MTPTACIESCG---AEGKFLFPAVAMGGICECVELDEINLSEVDAGATCDVPCRGDETLTCGGSEAYGVYIQRSLQNAVSIAAAADAFG 86 MTP CIE C A + F V G C C + ++ + + + C++PC+GD TL CGGS V+ + + A ++ FG Sbjct: 71 MTPALCIEFCSINFAPNGYGFAGVEFGQECWCDGVIQLT-ANLTGSSECNLPCKGDPTLDCGGSSRISVFTDGTSSPKIPSLALSNPFG 158 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6405.15082.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6405.15082.1 ID=prot_L-elsbetiae_contig6405.15082.1|Name=mRNA_L-elsbetiae_contig6405.15082.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=141bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|