prot_L-elsbetiae_contig6353.15011.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6353.15011.1 vs. uniprot
Match: A0A6H5JH16_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH16_9PHAE) HSP 1 Score: 114 bits (284), Expect = 5.380e-28 Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 0 Query: 3 RQDLNRGKSGDVVHLGYQVGGALSTVRLPFRPMILDRYPEQDSKMFPFPGDQLPMFVYP 61 ++DLNRGKSGDVV LGYQVGGALSTVRLPFR MILDRYPEQDS +FPFPGDQLPMFVYP Sbjct: 201 QKDLNRGKSGDVVQLGYQVGGALSTVRLPFRSMILDRYPEQDSPLFPFPGDQLPMFVYP 259
BLAST of mRNA_L-elsbetiae_contig6353.15011.1 vs. uniprot
Match: D7G3F8_ECTSI (UDENN domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3F8_ECTSI) HSP 1 Score: 113 bits (283), Expect = 7.330e-28 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0 Query: 4 QDLNRGKSGDVVHLGYQVGGALSTVRLPFRPMILDRYPEQDSKMFPFPGDQLPMFVYP 61 +DLNRGKSGDVV LGYQVGGALSTVRLPFR MILDRYPEQDS +FPFPGDQLPMFVYP Sbjct: 73 KDLNRGKSGDVVQLGYQVGGALSTVRLPFRSMILDRYPEQDSPLFPFPGDQLPMFVYP 130 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6353.15011.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6353.15011.1 ID=prot_L-elsbetiae_contig6353.15011.1|Name=mRNA_L-elsbetiae_contig6353.15011.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=61bpback to top |