|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | SMART | SM00364 | LRR_bac_2 | coord: 36..55 e-value: 70.0 score: 7.3 coord: 60..79 e-value: 230.0 score: 3.3 coord: 12..31 e-value: 100.0 score: 6.1 coord: 84..103 e-value: 110.0 score: 5.8 coord: 108..127 e-value: 200.0 score: 3.7 |
None | No IPR available | PANTHER | PTHR24366:SF102 | LEUCINE RICH REPEAT CONTAINING 15 | coord: 66..138 |
None | No IPR available | PANTHER | PTHR24366 | FAMILY NOT NAMED | coord: 66..138 |
None | No IPR available | PANTHER | PTHR24366 | FAMILY NOT NAMED | coord: 1..103 |
None | No IPR available | PANTHER | PTHR24366:SF102 | LEUCINE RICH REPEAT CONTAINING 15 | coord: 1..103 |
None | No IPR available | SUPERFAMILY | 52058 | L domain-like | coord: 2..138 |
IPR003591 | Leucine-rich repeat, typical subtype | SMART | SM00369 | LRR_typ_2 | coord: 60..83 e-value: 1.1E-4 score: 31.6 coord: 12..35 e-value: 0.0011 score: 28.3 coord: 36..59 e-value: 0.16 score: 21.1 coord: 84..107 e-value: 7.5E-6 score: 35.4 coord: 108..131 e-value: 4.4E-5 score: 32.9 |
IPR001611 | Leucine-rich repeat | PFAM | PF13855 | LRR_8 | coord: 62..121 e-value: 5.6E-16 score: 58.0 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 110..131 score: 7.273 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 14..35 score: 5.987 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 62..83 score: 7.15 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 38..59 score: 5.54 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 86..107 score: 8.074 |
IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 1..138 e-value: 9.5E-44 score: 151.2 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig634.14992.1 ID=prot_L-elsbetiae_contig634.14992.1|Name=mRNA_L-elsbetiae_contig634.14992.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=139bp LTTLPARVLDHLPRLKTLDFQYNKLRMVPDGIFDSVTLLKTLILGSNSLT TLPVGVFDRLTSLHTLDLSFNELATMPEEIFHHLTSLQHLDLRGNSIKEL PEGIFSSLTSLKTLDLRWNDLSELPAGIFHSLTSLETL* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|