prot_L-elsbetiae_contig6317.14958.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6317.14958.1 vs. uniprot
Match: D7G6T9_ECTSI (Tankyrase 1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G6T9_ECTSI) HSP 1 Score: 91.3 bits (225), Expect = 7.030e-18 Identity = 46/66 (69.70%), Postives = 48/66 (72.73%), Query Frame = 0 Query: 1 MVEYGGMDLAEVDKSGKTLVHVAAGHRHCHEVLAYLLEKGASLDTGDNSGVTPLHSAASSRNIGGI 66 MVE G MDL VD GKT VHVAAGHRHCHEVL YLL KGAS + D+ G PLH AAS RNI GI Sbjct: 60 MVESGEMDLTGVDGQGKTPVHVAAGHRHCHEVLVYLLGKGASFNRRDDLGAVPLHDAASHRNIVGI 125
BLAST of mRNA_L-elsbetiae_contig6317.14958.1 vs. uniprot
Match: A0A1W0A100_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0A100_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 8.560e-7 Identity = 30/62 (48.39%), Postives = 41/62 (66.13%), Query Frame = 0 Query: 7 MDLAEVDKSGKTLVHVAAGHRHCHEVLAYLLEKGASLDTGDNSGVTPLHSAASSRNIGGILL 68 +DLA+ D+ G TL+H AAG E+L LL +GA +DT +N G TPLH+AA+ N G+ L Sbjct: 136 IDLAKTDEDGMTLLHAAAGEEEASEILEILLNRGAQVDTKNNDGKTPLHTAAACGNFLGVKL 197 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6317.14958.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6317.14958.1 ID=prot_L-elsbetiae_contig6317.14958.1|Name=mRNA_L-elsbetiae_contig6317.14958.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=613bpback to top |