mRNA_L-elsbetiae_contig6307.14946.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6307.14946.1 vs. uniprot
Match: D7FPK8_ECTSI (Putative membrane transporter (ISS) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPK8_ECTSI) HSP 1 Score: 55.1 bits (131), Expect = 9.490e-6 Identity = 27/34 (79.41%), Postives = 29/34 (85.29%), Query Frame = 3 Query: 3 DDFGLSMCLLVAFPFLVAAAAIAYRLPDPPAPES 104 DDFGLSMCL+VA PFLVAA+AIAYRLP P P S Sbjct: 414 DDFGLSMCLVVACPFLVAASAIAYRLPGPATPPS 447
BLAST of mRNA_L-elsbetiae_contig6307.14946.1 vs. uniprot
Match: A0A6H5KIX3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIX3_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 4.280e-5 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 3 Query: 3 DDFGLSMCLLVAFPFLVAAAAIAYRLPDPPAPES 104 DDFGLSMCL+VA PFLVAAAAI+Y LP P P S Sbjct: 385 DDFGLSMCLVVACPFLVAAAAISYHLPGPATPPS 418 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6307.14946.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6307.14946.1 >prot_L-elsbetiae_contig6307.14946.1 ID=prot_L-elsbetiae_contig6307.14946.1|Name=mRNA_L-elsbetiae_contig6307.14946.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=152bp LTTSGCPCACSWRFLSSWRRRQLRIGCRIPRRLNLLARLPLWAIKATRATback to top mRNA from alignment at L-elsbetiae_contig6307:10413..11265- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6307.14946.1 ID=mRNA_L-elsbetiae_contig6307.14946.1|Name=mRNA_L-elsbetiae_contig6307.14946.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=853bp|location=Sequence derived from alignment at L-elsbetiae_contig6307:10413..11265- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6307:10413..11265- >mRNA_L-elsbetiae_contig6307.14946.1 ID=mRNA_L-elsbetiae_contig6307.14946.1|Name=mRNA_L-elsbetiae_contig6307.14946.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=912bp|location=Sequence derived from alignment at L-elsbetiae_contig6307:10413..11265- (Laminarionema elsbetiae ELsaHSoW15)back to top |