mRNA_L-elsbetiae_contig607.14610.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig607.14610.1 vs. uniprot
Match: A0A6H5LAT3_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LAT3_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 1.380e-10 Identity = 33/38 (86.84%), Postives = 35/38 (92.11%), Query Frame = -3 Query: 572 TGLEGYDSFGDLVRLLWAQDPNARPALQDVARLLRVPE 685 T LE YD+FGDLVRLLWAQDP ARPALQDVARLLRVP+ Sbjct: 1020 TALEDYDNFGDLVRLLWAQDPTARPALQDVARLLRVPD 1057
BLAST of mRNA_L-elsbetiae_contig607.14610.1 vs. uniprot
Match: D7FXM4_ECTSI (Protein kinase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXM4_ECTSI) HSP 1 Score: 70.9 bits (172), Expect = 1.850e-10 Identity = 33/38 (86.84%), Postives = 35/38 (92.11%), Query Frame = -3 Query: 572 TGLEGYDSFGDLVRLLWAQDPNARPALQDVARLLRVPE 685 T LE Y++FGDLVRLLWAQDP ARPALQDVARLLRVPE Sbjct: 1057 TALEDYENFGDLVRLLWAQDPTARPALQDVARLLRVPE 1094 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig607.14610.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig607.14610.1 >prot_L-elsbetiae_contig607.14610.1 ID=prot_L-elsbetiae_contig607.14610.1|Name=mRNA_L-elsbetiae_contig607.14610.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=231bp MGHRALLPYRSQQPRARSHLSVLPPKPLLPPSSPPPQSACRRCFHHSRCLback to top mRNA from alignment at L-elsbetiae_contig607:26717..27409+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig607.14610.1 ID=mRNA_L-elsbetiae_contig607.14610.1|Name=mRNA_L-elsbetiae_contig607.14610.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=693bp|location=Sequence derived from alignment at L-elsbetiae_contig607:26717..27409+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig607:26717..27409+ >mRNA_L-elsbetiae_contig607.14610.1 ID=mRNA_L-elsbetiae_contig607.14610.1|Name=mRNA_L-elsbetiae_contig607.14610.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1386bp|location=Sequence derived from alignment at L-elsbetiae_contig607:26717..27409+ (Laminarionema elsbetiae ELsaHSoW15)back to top |