prot_L-elsbetiae_contig6022.14555.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6022.14555.1 vs. uniprot
Match: D7G2U2_ECTSI (UBA domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2U2_ECTSI) HSP 1 Score: 82.8 bits (203), Expect = 1.220e-16 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0 Query: 33 LPPLLKAFSSLLRSLATIDWLAAALTMLTRWAHSRGAQTVAGQQAASRWGA 83 LPPLLKA S LLR LA +WLA ALT+LTRWAHSRGAQT AGQQAASRWGA Sbjct: 57 LPPLLKAMSGLLRCLAATEWLAGALTLLTRWAHSRGAQTAAGQQAASRWGA 107
BLAST of mRNA_L-elsbetiae_contig6022.14555.1 vs. uniprot
Match: A0A6H5LD86_9PHAE (DUF913 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LD86_9PHAE) HSP 1 Score: 81.3 bits (199), Expect = 4.180e-16 Identity = 41/51 (80.39%), Postives = 43/51 (84.31%), Query Frame = 0 Query: 33 LPPLLKAFSSLLRSLATIDWLAAALTMLTRWAHSRGAQTVAGQQAASRWGA 83 LPPLLKA S LLR L +WLA ALT+LTRWAHSRGAQT AGQQAASRWGA Sbjct: 727 LPPLLKAMSGLLRCLTATEWLAGALTLLTRWAHSRGAQTAAGQQAASRWGA 777 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6022.14555.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6022.14555.1 ID=prot_L-elsbetiae_contig6022.14555.1|Name=mRNA_L-elsbetiae_contig6022.14555.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=83bpback to top |