mRNA_L-elsbetiae_contig6022.14555.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6022.14555.1 vs. uniprot
Match: D7G2U2_ECTSI (UBA domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2U2_ECTSI) HSP 1 Score: 82.8 bits (203), Expect = 1.430e-16 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 110 LPPLLKAFSSLLRSLATIDWLAAALTMLTRWAHSRGAQTVAGQQAASRWGA 262 LPPLLKA S LLR LA +WLA ALT+LTRWAHSRGAQT AGQQAASRWGA Sbjct: 57 LPPLLKAMSGLLRCLAATEWLAGALTLLTRWAHSRGAQTAAGQQAASRWGA 107
BLAST of mRNA_L-elsbetiae_contig6022.14555.1 vs. uniprot
Match: A0A6H5LD86_9PHAE (DUF913 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LD86_9PHAE) HSP 1 Score: 81.3 bits (199), Expect = 4.910e-16 Identity = 41/51 (80.39%), Postives = 43/51 (84.31%), Query Frame = 2 Query: 110 LPPLLKAFSSLLRSLATIDWLAAALTMLTRWAHSRGAQTVAGQQAASRWGA 262 LPPLLKA S LLR L +WLA ALT+LTRWAHSRGAQT AGQQAASRWGA Sbjct: 727 LPPLLKAMSGLLRCLTATEWLAGALTLLTRWAHSRGAQTAAGQQAASRWGA 777 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6022.14555.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6022.14555.1 >prot_L-elsbetiae_contig6022.14555.1 ID=prot_L-elsbetiae_contig6022.14555.1|Name=mRNA_L-elsbetiae_contig6022.14555.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=83bp METETAAVADGGEGTKGSSEASPATTTTIVEGLPPLLKAFSSLLRSLATIback to top mRNA from alignment at L-elsbetiae_contig6022:11258..11519+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6022.14555.1 ID=mRNA_L-elsbetiae_contig6022.14555.1|Name=mRNA_L-elsbetiae_contig6022.14555.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=262bp|location=Sequence derived from alignment at L-elsbetiae_contig6022:11258..11519+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6022:11258..11519+ >mRNA_L-elsbetiae_contig6022.14555.1 ID=mRNA_L-elsbetiae_contig6022.14555.1|Name=mRNA_L-elsbetiae_contig6022.14555.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=498bp|location=Sequence derived from alignment at L-elsbetiae_contig6022:11258..11519+ (Laminarionema elsbetiae ELsaHSoW15)back to top |