mRNA_L-elsbetiae_contig5947.14435.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5947.14435.1 vs. uniprot
Match: A0A6H5KS62_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS62_9PHAE) HSP 1 Score: 95.1 bits (235), Expect = 9.090e-23 Identity = 46/52 (88.46%), Postives = 48/52 (92.31%), Query Frame = 1 Query: 1 MGGWLMFYSFGVAKCLLDHGLHKVRPMQQSFIGSSAGSLAAAALALEADIDK 156 MGGWLMFY+FGVAKCLLDHGLH VRP +QS IGSSAGSLAAAAL LEADIDK Sbjct: 154 MGGWLMFYTFGVAKCLLDHGLHNVRPTEQSVIGSSAGSLAAAALVLEADIDK 205
BLAST of mRNA_L-elsbetiae_contig5947.14435.1 vs. uniprot
Match: D7FRC4_ECTSI (PNPLA domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRC4_ECTSI) HSP 1 Score: 95.1 bits (235), Expect = 1.970e-21 Identity = 46/52 (88.46%), Postives = 48/52 (92.31%), Query Frame = 1 Query: 1 MGGWLMFYSFGVAKCLLDHGLHKVRPMQQSFIGSSAGSLAAAALALEADIDK 156 MGGWLMFY+FGVAKCLLDHGLH VRP +QS IGSSAGSLAAAAL LEADIDK Sbjct: 1 MGGWLMFYTFGVAKCLLDHGLHNVRPTEQSVIGSSAGSLAAAALVLEADIDK 52
BLAST of mRNA_L-elsbetiae_contig5947.14435.1 vs. uniprot
Match: A0A835ZCR0_9STRA (Acyl transferase/acyl hydrolase/lysophospholipase (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZCR0_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 4.190e-12 Identity = 35/50 (70.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 4 GGWLMFYSFGVAKCLLDHGLHKVRPMQQSFIGSSAGSLAAAALALEADID 153 GGWL FY FGVAKCL DHGLH V Q FIGSSAG+L AA +AL+AD D Sbjct: 24 GGWLQFYLFGVAKCLTDHGLHAVG-RSQKFIGSSAGALTAAGMALDADWD 72 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5947.14435.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5947.14435.1 >prot_L-elsbetiae_contig5947.14435.1 ID=prot_L-elsbetiae_contig5947.14435.1|Name=mRNA_L-elsbetiae_contig5947.14435.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=61bp MGGWLMFYSFGVAKCLLDHGLHKVRPMQQSFIGSSAGSLAAAALALEADIback to top mRNA from alignment at L-elsbetiae_contig5947:3062..3244+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5947.14435.1 ID=mRNA_L-elsbetiae_contig5947.14435.1|Name=mRNA_L-elsbetiae_contig5947.14435.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=183bp|location=Sequence derived from alignment at L-elsbetiae_contig5947:3062..3244+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5947:3062..3244+ >mRNA_L-elsbetiae_contig5947.14435.1 ID=mRNA_L-elsbetiae_contig5947.14435.1|Name=mRNA_L-elsbetiae_contig5947.14435.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=366bp|location=Sequence derived from alignment at L-elsbetiae_contig5947:3062..3244+ (Laminarionema elsbetiae ELsaHSoW15)back to top |