mRNA_L-elsbetiae_contig5752.14155.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5752.14155.1 vs. uniprot
Match: D8LED7_ECTSI (EsV-1-166 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LED7_ECTSI) HSP 1 Score: 89.4 bits (220), Expect = 9.800e-19 Identity = 39/67 (58.21%), Postives = 48/67 (71.64%), Query Frame = 2 Query: 86 VVIIEAEDLEVSGAWSVISDTRASGNEYIAWEGLGFQEQNDDYREGDVITTIIHIPTAGTYSFQWLM 286 VVIIEAEDL V+G W ++ D ASG YI WEGL + N D +GD+I+T + IPTAGTYSF+W M Sbjct: 733 VVIIEAEDLPVNGDWRIVQDNAASGGAYITWEGLSEAQNNSDPADGDIISTSVQIPTAGTYSFKWAM 799
BLAST of mRNA_L-elsbetiae_contig5752.14155.1 vs. uniprot
Match: A0A6H5JMV6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMV6_9PHAE) HSP 1 Score: 88.2 bits (217), Expect = 2.180e-18 Identity = 39/67 (58.21%), Postives = 48/67 (71.64%), Query Frame = 2 Query: 86 VVIIEAEDLEVSGAWSVISDTRASGNEYIAWEGLGFQEQNDDYREGDVITTIIHIPTAGTYSFQWLM 286 VVIIEAEDL V+G W ++ D ASG YI WEGL + N D +GD+I+T + IPTAGTYSF+W M Sbjct: 314 VVIIEAEDLPVNGDWRIVQDNAASGGAYITWEGLSEAQNNRDPGDGDIISTSVQIPTAGTYSFKWAM 380
BLAST of mRNA_L-elsbetiae_contig5752.14155.1 vs. uniprot
Match: D7FU28_ECTSI (EsV-1-166 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FU28_ECTSI) HSP 1 Score: 84.3 bits (207), Expect = 5.560e-17 Identity = 39/71 (54.93%), Postives = 50/71 (70.42%), Query Frame = 2 Query: 74 GCTAVVIIEAEDLEVSGAWSVISDTRASGNEYIAWEGLGFQEQNDDYREGDVITTIIHIPTAGTYSFQWLM 286 GC VV +EAEDL V G W V++D ASG +YI WEGL + N D +GD+++ I +PTAGTYSF+WLM Sbjct: 593 GCM-VVRMEAEDLPVLGDWRVVNDADASGGKYITWEGLSEGQNNGDPADGDIMSASIQVPTAGTYSFKWLM 662 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5752.14155.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5752.14155.1 >prot_L-elsbetiae_contig5752.14155.1 ID=prot_L-elsbetiae_contig5752.14155.1|Name=mRNA_L-elsbetiae_contig5752.14155.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=96bp KRRPCHQRLLRPDNGSPVQNRRRLRLHRGGDNRGRRSRGIGRMERHFRHPback to top mRNA from alignment at L-elsbetiae_contig5752:2714..3138- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5752.14155.1 ID=mRNA_L-elsbetiae_contig5752.14155.1|Name=mRNA_L-elsbetiae_contig5752.14155.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=425bp|location=Sequence derived from alignment at L-elsbetiae_contig5752:2714..3138- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5752:2714..3138- >mRNA_L-elsbetiae_contig5752.14155.1 ID=mRNA_L-elsbetiae_contig5752.14155.1|Name=mRNA_L-elsbetiae_contig5752.14155.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=576bp|location=Sequence derived from alignment at L-elsbetiae_contig5752:2714..3138- (Laminarionema elsbetiae ELsaHSoW15)back to top |