Homology
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig569.14057.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR003591 | Leucine-rich repeat, typical subtype | SMART | SM00369 | LRR_typ_2 | coord: 68..88 e-value: 260.0 score: 1.7 coord: 110..133 e-value: 0.47 score: 19.5 coord: 89..109 e-value: 15.0 score: 11.8 |
IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 10..143 e-value: 1.6E-17 score: 65.4 |
IPR001611 | Leucine-rich repeat | PFAM | PF13855 | LRR_8 | coord: 67..113 e-value: 5.6E-8 score: 32.4 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 113..133 score: 6.742 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 91..112 score: 7.527 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 67..88 score: 4.724 |
None | No IPR available | PANTHER | PTHR45712 | FAMILY NOT NAMED | coord: 66..140 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..20 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 21..144 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 6..15 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 16..20 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..5 |
None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..23 score: 0.455 |
None | No IPR available | SUPERFAMILY | 52058 | L domain-like | coord: 40..141 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig569.14057.1 ID=prot_L-elsbetiae_contig569.14057.1|Name=mRNA_L-elsbetiae_contig569.14057.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=145bp MRFVRVAAVLSAICIDKIRAVAGESTCLSDGRCILGTSTLNLCNCDLEDN DMDGIAECIADSQSAGTLQVLRICNNFLTYLASDVLQGLPQLERLHLNEN NLTEVPSLHFEHLFYLRLDNNYISSLESDAFQGTPKIEQLTTSP* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|