mRNA_L-elsbetiae_contig551.13786.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig551.13786.1 vs. uniprot
Match: A0A6H5JP83_9PHAE (EAF domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JP83_9PHAE) HSP 1 Score: 82.0 bits (201), Expect = 7.310e-15 Identity = 42/69 (60.87%), Postives = 46/69 (66.67%), Query Frame = 1 Query: 1 GEWGGRPALRDAAVRHTLFACSSHLADSLGRS----PDASCLEAHGRLVSALKVCYVMRGFVASSPPRP 195 GEW RPAL DA VRHTLFAC HLA+ L + PD S L HG+LVSALK C+VMRGFV P P Sbjct: 382 GEWSRRPALNDANVRHTLFACCCHLAEGLPAATSPPPDDSRLRGHGKLVSALKACHVMRGFVTDGHPLP 450
BLAST of mRNA_L-elsbetiae_contig551.13786.1 vs. uniprot
Match: D7FRR3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRR3_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 3.770e-13 Identity = 41/69 (59.42%), Postives = 46/69 (66.67%), Query Frame = 1 Query: 1 GEWGGRPALRDAAVRHTLFACSSHLADSLGRS----PDASCLEAHGRLVSALKVCYVMRGFVASSPPRP 195 GEW RPAL DA VRHTLFAC +LA+ L + PD S L G+LVSALK C+VMRGFVA P P Sbjct: 388 GEWTRRPALNDANVRHTLFACCCNLAEGLPAAACPPPDDSRLRGRGKLVSALKACHVMRGFVADGHPLP 456 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig551.13786.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig551.13786.1 >prot_L-elsbetiae_contig551.13786.1 ID=prot_L-elsbetiae_contig551.13786.1|Name=mRNA_L-elsbetiae_contig551.13786.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=182bp GEWGGRPALRDAAVRHTLFACSSHLADSLGRSPDASCLEAHGRLVSALKVback to top mRNA from alignment at L-elsbetiae_contig551:17597..18759- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig551.13786.1 ID=mRNA_L-elsbetiae_contig551.13786.1|Name=mRNA_L-elsbetiae_contig551.13786.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1163bp|location=Sequence derived from alignment at L-elsbetiae_contig551:17597..18759- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig551:17597..18759- >mRNA_L-elsbetiae_contig551.13786.1 ID=mRNA_L-elsbetiae_contig551.13786.1|Name=mRNA_L-elsbetiae_contig551.13786.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1092bp|location=Sequence derived from alignment at L-elsbetiae_contig551:17597..18759- (Laminarionema elsbetiae ELsaHSoW15)back to top |