prot_L-elsbetiae_contig5486.13747.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5486.13747.1 vs. uniprot
Match: A0A6H5K4N3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4N3_9PHAE) HSP 1 Score: 109 bits (272), Expect = 8.830e-26 Identity = 54/96 (56.25%), Postives = 69/96 (71.88%), Query Frame = 0 Query: 1 MVNVDFVDDYGNAISFPSNHANDDPAAPASLHEALDSVNLGLSKRELHARYGEDTTPLENVLSDWLLCLASENTDVLRKTDLSGGFGADEAQDGSG 96 MVN+++ DD+GNAIS P NH+ D+P AP L EALD ++ +KREL+A YGEDT+PLE + WL LA ENT+++RK D SGG GAD A D G Sbjct: 297 MVNLEYKDDHGNAISVPVNHSYDNPEAPEELFEALDGIDFERTKRELNALYGEDTSPLERQVPVWLRYLAGENTELIRKRDASGGVGADAADDDEG 392 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5486.13747.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5486.13747.1 ID=prot_L-elsbetiae_contig5486.13747.1|Name=mRNA_L-elsbetiae_contig5486.13747.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=97bpback to top |