prot_L-elsbetiae_contig5443.13689.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: D7FH97_ECTSI (Similar to chromosome fragility associated gene 1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH97_ECTSI) HSP 1 Score: 71.2 bits (173), Expect = 2.410e-13 Identity = 30/38 (78.95%), Postives = 36/38 (94.74%), Query Frame = 0 Query: 5 QYDWIPYSDDD-DEDSRLCNMAMLCGPPGVGKTSAVYG 41 +YDW+ +SD++ DED+RLCNMAMLCGPPGVGKTSAVYG Sbjct: 857 EYDWVRFSDEEEDEDARLCNMAMLCGPPGVGKTSAVYG 894
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: UPI0014585F3B (ATPase family AAA domain-containing protein 5-like isoform X1 n=2 Tax=Pecten maximus TaxID=6579 RepID=UPI0014585F3B) HSP 1 Score: 49.3 bits (116), Expect = 1.330e-5 Identity = 19/25 (76.00%), Postives = 21/25 (84.00%), Query Frame = 0 Query: 17 EDSRLCNMAMLCGPPGVGKTSAVYG 41 ED RLCN AMLCGP G+GKT+ VYG Sbjct: 1073 EDDRLCNTAMLCGPSGIGKTATVYG 1097
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: A0A210QA61_MIZYE (ATPase family AAA domain-containing protein 5 n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QA61_MIZYE) HSP 1 Score: 48.1 bits (113), Expect = 3.420e-5 Identity = 18/25 (72.00%), Postives = 22/25 (88.00%), Query Frame = 0 Query: 17 EDSRLCNMAMLCGPPGVGKTSAVYG 41 E+ RLCN AMLCGP G+GKT++VYG Sbjct: 1071 EEDRLCNTAMLCGPSGIGKTASVYG 1095
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: A0A8D0BEM7_9SAUR (ATPase_AAA_core domain-containing protein n=1 Tax=Salvator merianae TaxID=96440 RepID=A0A8D0BEM7_9SAUR) HSP 1 Score: 47.4 bits (111), Expect = 6.410e-5 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 7 DWIPYSDDDDEDSRLCNMAMLCGPPGVGKTSAVY 40 D+ Y D +E+S LCN +L GPPG+GKT+AVY Sbjct: 780 DFKDYGSDSEEESVLCNTVLLTGPPGIGKTAAVY 813
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: F6ZIX7_MONDO (AAA domain-containing protein n=3 Tax=Didelphinae TaxID=126287 RepID=F6ZIX7_MONDO) HSP 1 Score: 47.0 bits (110), Expect = 8.760e-5 Identity = 22/40 (55.00%), Postives = 28/40 (70.00%), Query Frame = 0 Query: 1 DNKYQYDWIPYSDDDDEDSRLCNMAMLCGPPGVGKTSAVY 40 D + D+ SDD+DE S LCN ++ GPPGVGKT+AVY Sbjct: 1138 DLSFSMDFKDLSDDEDESS-LCNTVLITGPPGVGKTAAVY 1176 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5443.13689.1 ID=prot_L-elsbetiae_contig5443.13689.1|Name=mRNA_L-elsbetiae_contig5443.13689.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bpback to top |