mRNA_L-elsbetiae_contig5401.13629.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5401.13629.1 vs. uniprot
Match: D8LDX8_ECTSI (Kinesin motor domain-containing protein (Fragment) n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LDX8_ECTSI) HSP 1 Score: 77.8 bits (190), Expect = 1.800e-15 Identity = 36/38 (94.74%), Postives = 38/38 (100.00%), Query Frame = 1 Query: 1 QVESLRSMLQASRDRNGVYIEPWRFDQMENTLASQGNQ 114 +VESLRSMLQASRD+NGVYIEPWRFDQMENTLASQGNQ Sbjct: 358 EVESLRSMLQASRDKNGVYIEPWRFDQMENTLASQGNQ 395
BLAST of mRNA_L-elsbetiae_contig5401.13629.1 vs. uniprot
Match: A0A836CEW9_9STRA (P-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CEW9_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 9.650e-5 Identity = 20/37 (54.05%), Postives = 31/37 (83.78%), Query Frame = 1 Query: 1 QVESLRSMLQASRDRNGVYIEPWRFDQMENTLASQGN 111 ++ESLRSMLQA+R++NGVY++P ++Q+E+ SQ N Sbjct: 322 EIESLRSMLQAAREKNGVYLDPAYYEQIESARESQKN 358 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5401.13629.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5401.13629.1 >prot_L-elsbetiae_contig5401.13629.1 ID=prot_L-elsbetiae_contig5401.13629.1|Name=mRNA_L-elsbetiae_contig5401.13629.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=44bp MLQASRDRNGVYIEPWRFDQMENTLASQGNQARTASPCRLSWK*back to top mRNA from alignment at L-elsbetiae_contig5401:683..835+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5401.13629.1 ID=mRNA_L-elsbetiae_contig5401.13629.1|Name=mRNA_L-elsbetiae_contig5401.13629.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=153bp|location=Sequence derived from alignment at L-elsbetiae_contig5401:683..835+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5401:683..835+ >mRNA_L-elsbetiae_contig5401.13629.1 ID=mRNA_L-elsbetiae_contig5401.13629.1|Name=mRNA_L-elsbetiae_contig5401.13629.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=264bp|location=Sequence derived from alignment at L-elsbetiae_contig5401:683..835+ (Laminarionema elsbetiae ELsaHSoW15)back to top |