prot_L-elsbetiae_contig5355.13538.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5355.13538.1 vs. uniprot
Match: D8LDE8_ECTSI (RNA pseudouridylate synthase domain-containing protein (C-terminal) RNA pseudouridylate synthase dom n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDE8_ECTSI) HSP 1 Score: 129 bits (323), Expect = 2.240e-33 Identity = 70/127 (55.12%), Postives = 78/127 (61.42%), Query Frame = 0 Query: 1 MVHKIRNELVTRHEPEGRATVFNRLAKLEMPDTLMPL-----------------------------------------ITEEELSGMRSGCTIDGVRYKGMFVRVGTGGGKGTGGRNAWLTIKCTEG 86 MVHK+RNELVTRH+PEGR TVF+RL KL++PDTLMP+ ITEE+L MRSGCTIDGVRYKGMFVRV GGGKG GRNAWLTI+CTEG Sbjct: 196 MVHKMRNELVTRHDPEGRPTVFDRLTKLKLPDTLMPVGRLDYNTEGLLLLTNDGDLARKMELPSSNIVRTYSVRVYGNITEEKLRAMRSGCTIDGVRYKGMFVRVEGGGGKGREGRNAWLTIECTEG 322
BLAST of mRNA_L-elsbetiae_contig5355.13538.1 vs. uniprot
Match: A0A6H5J790_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J790_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 5.820e-16 Identity = 36/41 (87.80%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 46 MRSGCTIDGVRYKGMFVRVGTGGGKGTGGRNAWLTIKCTEG 86 MRSGCTIDGVRYKGMFVRV GGGKG GRNAWLTI+CTEG Sbjct: 1 MRSGCTIDGVRYKGMFVRVEGGGGKGREGRNAWLTIECTEG 41
BLAST of mRNA_L-elsbetiae_contig5355.13538.1 vs. uniprot
Match: A0A6H5J9J6_9PHAE (S4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J9J6_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 2.280e-10 Identity = 29/37 (78.38%), Postives = 35/37 (94.59%), Query Frame = 0 Query: 1 MVHKIRNELVTRHEPEGRATVFNRLAKLEMPDTLMPL 37 MVHK+RNELVTR +PEGR TVF+RLAKL++PDTLMP+ Sbjct: 214 MVHKMRNELVTRDDPEGRPTVFDRLAKLKLPDTLMPV 250
BLAST of mRNA_L-elsbetiae_contig5355.13538.1 vs. uniprot
Match: A0A7S2KG34_9STRA (Hypothetical protein n=2 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2KG34_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 1.670e-5 Identity = 27/49 (55.10%), Postives = 32/49 (65.31%), Query Frame = 0 Query: 38 ITEEELSGMRSGCTIDGVRYKGMFVRVGTGGGKGTGGRNAWLTIKCTEG 86 +T +LS +R G I+GVRYKGM VR+ G GG N WL IKCTEG Sbjct: 199 LTFGKLSAIRRGVEINGVRYKGMDVRIE--GNLKKGGTNTWLQIKCTEG 245 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5355.13538.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5355.13538.1 ID=prot_L-elsbetiae_contig5355.13538.1|Name=mRNA_L-elsbetiae_contig5355.13538.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=87bpback to top |