prot_L-elsbetiae_contig5328.13493.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5328.13493.1 vs. uniprot
Match: D8LJE2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJE2_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 1.380e-7 Identity = 30/47 (63.83%), Postives = 35/47 (74.47%), Query Frame = 0 Query: 14 GHQAQVKCLSIDSRGELLVSGDESGSICARLLHPRQSHSSSPRGWGT 60 G + +V CLSID RGELLV+GDESG+ICARLLH HS + G GT Sbjct: 12 GRRQKVGCLSIDRRGELLVTGDESGAICARLLH----HSGNRSGDGT 54
BLAST of mRNA_L-elsbetiae_contig5328.13493.1 vs. uniprot
Match: A0A6H5L2I0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2I0_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 1.680e-6 Identity = 29/42 (69.05%), Postives = 32/42 (76.19%), Query Frame = 0 Query: 19 VKCLSIDSRGELLVSGDESGSICARLLHPRQSHSSSPRGWGT 60 V CLSID RGELLV+GDESG+ICARLLH HS + G GT Sbjct: 5 VGCLSIDRRGELLVTGDESGAICARLLH----HSGNRSGDGT 42 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5328.13493.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5328.13493.1 ID=prot_L-elsbetiae_contig5328.13493.1|Name=mRNA_L-elsbetiae_contig5328.13493.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=82bpback to top |