prot_L-elsbetiae_contig529.13428.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig529.13428.1 vs. uniprot
Match: A0A6H5KVK7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVK7_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 1.250e-10 Identity = 40/56 (71.43%), Postives = 42/56 (75.00%), Query Frame = 0 Query: 156 SGGAGTGAGREAATEAMRGPLVEALHQIAQLPFSAAELWSLHQFYFSPP-EAHPRP 210 SGG GT A EA+R LVEALHQIAQLPFSAAELWSLHQ YFSPP + HP P Sbjct: 799 SGGDGTERAAAAVPEALRASLVEALHQIAQLPFSAAELWSLHQHYFSPPLDHHPSP 854
BLAST of mRNA_L-elsbetiae_contig529.13428.1 vs. uniprot
Match: D7FK51_ECTSI (Hypothetical leucine rich repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK51_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 1.340e-9 Identity = 35/45 (77.78%), Postives = 37/45 (82.22%), Query Frame = 0 Query: 167 AATEAMRGPLVEALHQIAQLPFSAAELWSLHQFYFSPP-EAHPRP 210 A EA+R LVEALHQIAQLPFSAAELWSLHQ YFSPP + HP P Sbjct: 662 AVPEALRASLVEALHQIAQLPFSAAELWSLHQHYFSPPLDHHPSP 706 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig529.13428.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig529.13428.1 ID=prot_L-elsbetiae_contig529.13428.1|Name=mRNA_L-elsbetiae_contig529.13428.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=243bpback to top |