mRNA_L-elsbetiae_contig5097.13136.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5097.13136.1 vs. uniprot
Match: D8LT27_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LT27_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 5.160e-11 Identity = 36/41 (87.80%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 47 APALSPELGKAEARQASNLRVTTKAIDALHARIAKAKLALD 169 APALSPEL KAEARQASNLRVTTKAIDALHAR+A+AK LD Sbjct: 9 APALSPELNKAEARQASNLRVTTKAIDALHARVARAKRELD 49
BLAST of mRNA_L-elsbetiae_contig5097.13136.1 vs. uniprot
Match: A0A6H5K8M5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8M5_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 1.270e-9 Identity = 35/41 (85.37%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 47 APALSPELGKAEARQASNLRVTTKAIDALHARIAKAKLALD 169 APAL PEL KAEARQASNLRVTTKAIDALHAR+A+AK LD Sbjct: 9 APALGPELNKAEARQASNLRVTTKAIDALHARVARAKRELD 49 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5097.13136.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5097.13136.1 >prot_L-elsbetiae_contig5097.13136.1 ID=prot_L-elsbetiae_contig5097.13136.1|Name=mRNA_L-elsbetiae_contig5097.13136.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=147bp MSTPGSHHHAAPAPAAPALSPELGKAEARQASNLRVTTKAIDALHARIAKback to top mRNA from alignment at L-elsbetiae_contig5097:9804..10245+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5097.13136.1 ID=mRNA_L-elsbetiae_contig5097.13136.1|Name=mRNA_L-elsbetiae_contig5097.13136.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=442bp|location=Sequence derived from alignment at L-elsbetiae_contig5097:9804..10245+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5097:9804..10245+ >mRNA_L-elsbetiae_contig5097.13136.1 ID=mRNA_L-elsbetiae_contig5097.13136.1|Name=mRNA_L-elsbetiae_contig5097.13136.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=882bp|location=Sequence derived from alignment at L-elsbetiae_contig5097:9804..10245+ (Laminarionema elsbetiae ELsaHSoW15)back to top |