mRNA_L-elsbetiae_contig5079.13110.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Match: A0A6H5JW94_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JW94_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 8.760e-9 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = 2 Query: 23 MVNVINKTCGHPDCNKRPSYGMAGSKTAEFCAGHAQEGMVDV 148 M NV++K CGHP C K+PS+G AGSK AEFC HA++ MV V Sbjct: 1 MFNVVDKRCGHPGCTKKPSFGTAGSKRAEFCCPHAKQDMVIV 42
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Match: D8LFX6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LFX6_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 2.160e-8 Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2 Query: 5 GHAKEGMVNVINKTCGHPD-CNKRPSYGMAGSKTAEFCAGHAQEGMVDV 148 GHAKEGM+NV ++TC HP C RPSY AGSK EFC HA +G VDV Sbjct: 30 GHAKEGMINVRDRTCCHPGGCPTRPSYAEAGSKKPEFCVLHAPKGTVDV 78
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Match: A0A6H5LBM3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LBM3_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 8.880e-7 Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 2 Query: 8 HAKEGMVNVIN-KTCGHPDCNKRPSYGMAGSKTAEFCAGHAQEGMV 142 H +GMV++ N + C H DC K P+YG+ G++ AEFCA HA +GMV Sbjct: 3 HFTDGMVDIHNIRRCAHEDCVKHPTYGVPGTRKAEFCAPHALDGMV 48
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Match: A0A6H5KV69_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KV69_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 1.470e-5 Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 2 Query: 47 CGHPDCNKRPSYGMAGSKTAEFCAGHAQEGMVDV 148 CGHP CNK PS+G +G++ A+FCA HA EG+VDV Sbjct: 6 CGHPSCNKNPSFGESGTRRAQFCAEHAPEGLVDV 39
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Match: D8LCH9_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCH9_ECTSI) HSP 1 Score: 54.7 bits (130), Expect = 3.730e-5 Identity = 22/42 (52.38%), Postives = 31/42 (73.81%), Query Frame = 2 Query: 23 MVNVINKTCGHPDCNKRPSYGMAGSKTAEFCAGHAQEGMVDV 148 M++V KTC H C R ++G+ GSK AEFC+ HA++GMVD+ Sbjct: 1 MIHVRAKTCDHVGCTTRANFGVPGSKKAEFCSRHAEDGMVDL 42
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 4.840e-5 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 2 Query: 47 CGHPDCNKRPSYGMAGSKTAEFCAGHAQEGMVDV 148 CGH +C KRP+YG+AGSK EFC+ HA++GMV+V Sbjct: 4 CGHANCTKRPTYGVAGSKKREFCSQHARDGMVNV 37
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 6.160e-5 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 2 Query: 47 CGHPDCNKRPSYGMAGSKTAEFCAGHAQEGMVDV 148 CGH +C KRP+YG+AGSK EFC+ HA++GMV+V Sbjct: 64 CGHENCTKRPTYGVAGSKKREFCSQHARDGMVNV 97 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5079.13110.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5079.13110.1 >prot_L-elsbetiae_contig5079.13110.1 ID=prot_L-elsbetiae_contig5079.13110.1|Name=mRNA_L-elsbetiae_contig5079.13110.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=222bp MVNVINKTCGHPDCNKRPSYGMAGSKTAEFCAGHAQEGMVDVNKTCGHPDback to top mRNA from alignment at L-elsbetiae_contig5079:1087..3546+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5079.13110.1 ID=mRNA_L-elsbetiae_contig5079.13110.1|Name=mRNA_L-elsbetiae_contig5079.13110.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=2460bp|location=Sequence derived from alignment at L-elsbetiae_contig5079:1087..3546+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5079:1087..3546+ >mRNA_L-elsbetiae_contig5079.13110.1 ID=mRNA_L-elsbetiae_contig5079.13110.1|Name=mRNA_L-elsbetiae_contig5079.13110.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1332bp|location=Sequence derived from alignment at L-elsbetiae_contig5079:1087..3546+ (Laminarionema elsbetiae ELsaHSoW15)back to top |