prot_L-elsbetiae_contig5003.13008.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5003.13008.1 vs. uniprot
Match: A0A6H5K9R0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K9R0_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 2.630e-11 Identity = 44/62 (70.97%), Postives = 47/62 (75.81%), Query Frame = 0 Query: 36 SSAELAAVREQVETLKQQLVMVGVQQLALTGVPTGAALLN-RHEG-----AFPFHGPALPAA 91 SSAEL AV+EQ+E LKQQLVMVGVQQLALTGVPTGAALL+ RH G A PF P AA Sbjct: 674 SSAELDAVKEQMEVLKQQLVMVGVQQLALTGVPTGAALLSGRHSGRGGGPARPFKDPPAAAA 735
BLAST of mRNA_L-elsbetiae_contig5003.13008.1 vs. uniprot
Match: D7FS85_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS85_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 8.870e-11 Identity = 48/77 (62.34%), Postives = 52/77 (67.53%), Query Frame = 0 Query: 20 SPEWRRP--EGGGQGDAASSAELAAVREQVETLKQQLVMVGVQQLALTGVPTGAALLN-RHEG------AFPFHGPA 87 SP+ RP EG AA S EL V+EQ+E LKQQLVMVGVQQLALTGV TGAALLN RH G A PF+ PA Sbjct: 570 SPKRVRPCLEGEAVPGAAFSVELDPVKEQMEILKQQLVMVGVQQLALTGVRTGAALLNGRHSGGSGGGPAHPFNDPA 646 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5003.13008.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5003.13008.1 ID=prot_L-elsbetiae_contig5003.13008.1|Name=mRNA_L-elsbetiae_contig5003.13008.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=167bpback to top |