prot_L-elsbetiae_contig496.12933.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig496.12933.1 vs. uniprot
Match: D8LBE8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBE8_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 9.690e-12 Identity = 29/36 (80.56%), Postives = 34/36 (94.44%), Query Frame = 0 Query: 84 QKEEFPLTSTPLDTWVGRYVRITSPKHNGTTGLVHR 119 +K+EFPL S PLDTWVGR+VRIT+P+HNGTTGLVHR Sbjct: 79 RKDEFPLISVPLDTWVGRFVRITTPRHNGTTGLVHR 114
BLAST of mRNA_L-elsbetiae_contig496.12933.1 vs. uniprot
Match: A0A6H5JHP0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHP0_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 1.280e-11 Identity = 29/35 (82.86%), Postives = 33/35 (94.29%), Query Frame = 0 Query: 85 KEEFPLTSTPLDTWVGRYVRITSPKHNGTTGLVHR 119 K+EFPL S PLDTWVGR+VRIT+P+HNGTTGLVHR Sbjct: 104 KDEFPLISVPLDTWVGRFVRITTPRHNGTTGLVHR 138 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig496.12933.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig496.12933.1 ID=prot_L-elsbetiae_contig496.12933.1|Name=mRNA_L-elsbetiae_contig496.12933.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=119bpback to top |