prot_L-elsbetiae_contig4928.12887.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig4928.12887.1 vs. uniprot
Match: D7FT02_ECTSI (Serine--tRNA ligase n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FT02_ECTSI) HSP 1 Score: 89.7 bits (221), Expect = 2.030e-18 Identity = 48/58 (82.76%), Postives = 52/58 (89.66%), Query Frame = 0 Query: 40 AITAKIAAKGNEIRELKKSKADKATLQPHIDALIALKTQCRDETGKAGVAPGTPASAS 97 AITAKI AKG+EIRELKKSK DKAT+QPHIDALIALKTQ +DETGKA VAPG A+AS Sbjct: 581 AITAKIVAKGDEIRELKKSKPDKATIQPHIDALIALKTQYKDETGKAYVAPGATANAS 638
BLAST of mRNA_L-elsbetiae_contig4928.12887.1 vs. uniprot
Match: A0A836CAY7_9STRA (Serine--tRNA ligase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CAY7_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 1.250e-7 Identity = 32/53 (60.38%), Postives = 40/53 (75.47%), Query Frame = 0 Query: 39 AAITAKIAAKGNEIRELKKSKADKATLQPHIDALIALKTQCRDETGKAGVAPG 91 A I AKIA+ G+ IR+LKK+KADKA LQP+IDAL+ LK Q ++ TG APG Sbjct: 589 AEIAAKIASTGDAIRDLKKAKADKAQLQPYIDALLDLKRQYKEATGADYAAPG 641 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig4928.12887.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig4928.12887.1 ID=prot_L-elsbetiae_contig4928.12887.1|Name=mRNA_L-elsbetiae_contig4928.12887.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=123bpback to top |