prot_L-elsbetiae_contig4855.12762.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig4855.12762.1 vs. uniprot
Match: A0A6H5JSB4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSB4_9PHAE) HSP 1 Score: 100 bits (248), Expect = 2.770e-22 Identity = 55/119 (46.22%), Postives = 70/119 (58.82%), Query Frame = 0 Query: 2 VRVEKFVIDHEVYISSASCFCSACREGCYDECFVRASYPALVPKRVLGVVEETVTLDTGVDPAHVGAVVG----------------DSIKQVKGVTFGKRQNARVMQRITGTEVEKSLL 104 V VEK +DHEVY S +SCFCSACR YD+CFV A YPALVPK L VVEE V +DTGVDP V D+ K+ + + F K+ + +MQR+TGT+ E+ + Sbjct: 642 VSVEKRTVDHEVYTSQSSCFCSACRVRGYDKCFVFAKYPALVPKLQLSVVEEKVVMDTGVDPVGAEEKVXXXXXXXXXXXXXXXEVDARKEKQEIKFRKKSSVCLMQRVTGTQFEEKYI 760 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig4855.12762.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig4855.12762.1 ID=prot_L-elsbetiae_contig4855.12762.1|Name=mRNA_L-elsbetiae_contig4855.12762.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=109bpback to top |