mRNA_L-elsbetiae_contig10995.889.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5JKS3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKS3_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 1.390e-6 Identity = 23/32 (71.88%), Postives = 25/32 (78.12%), Query Frame = 3 Query: 186 DTERMPKRDGEPGVDKPVREAIGCLTWLAAFT 281 + E PKRD EPGVDKPVR+AIGCL W A FT Sbjct: 1009 NAELGPKRDDEPGVDKPVRQAIGCLMWPATFT 1040
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5L175_9PHAE (Uncharacterized protein n=9 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L175_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 2.620e-6 Identity = 22/27 (81.48%), Postives = 23/27 (85.19%), Query Frame = 3 Query: 201 PKRDGEPGVDKPVREAIGCLTWLAAFT 281 PKRD EPGVDKPVR+AIGCL W A FT Sbjct: 1567 PKRDDEPGVDKPVRQAIGCLMWPATFT 1593
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5JK49_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK49_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 3.540e-6 Identity = 23/36 (63.89%), Postives = 26/36 (72.22%), Query Frame = 1 Query: 115 KVVRALYGVEQSGREWGNEAADTLIQNGCRSETASP 222 KV RALYG++QSGREWG E AD LI+NGC P Sbjct: 426 KVERALYGLKQSGREWGFEVADALIENGCEQCRVDP 461
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5JUB8_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUB8_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 4.820e-6 Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 1 Query: 61 PGGAGSRSTCSAPQRLDTKVVRALYGVEQSGREWGNEAADTLIQNGCRSETASP 222 P G G +S + TK RA+YG++QSGR+WG AADTL++NG A P Sbjct: 377 PAGCGDKS------HMITKAERAIYGLKQSGRQWGYHAADTLVENGFEQCKADP 424
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5L5Z2_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5Z2_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 4.920e-6 Identity = 25/36 (69.44%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 115 KVVRALYGVEQSGREWGNEAADTLIQNGCRSETASP 222 KV RALYG++QSGREWG EAADTLI NG A P Sbjct: 393 KVERALYGLKQSGREWGFEAADTLIANGYEQCRADP 428
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5JC05_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC05_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 8.620e-6 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 1 Query: 115 KVVRALYGVEQSGREWGNEAADTLIQNG---CR 204 KV RALYG++QSGREWG EAAD LI+NG CR Sbjct: 76 KVERALYGLKQSGREWGFEAADALIENGYEQCR 108
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5L9H4_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L9H4_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 8.780e-6 Identity = 24/36 (66.67%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 115 KVVRALYGVEQSGREWGNEAADTLIQNGCRSETASP 222 KV RALYG++QSGREWG EAAD LI+NG A P Sbjct: 333 KVERALYGLKQSGREWGFEAADALIENGYEQCRADP 368
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5JXU1_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXU1_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 1.190e-5 Identity = 25/42 (59.52%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 88 CSAPQRLDTKVVRALYGVEQSGREWGNEAADTLIQNG---CR 204 CS+ K+ RALYG++QSGREWG EAAD LI+NG CR Sbjct: 67 CSSMSGKVVKIERALYGLKQSGREWGFEAADALIENGYEQCR 108
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5JNJ1_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNJ1_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 1.200e-5 Identity = 25/44 (56.82%), Postives = 28/44 (63.64%), Query Frame = 1 Query: 115 KVVRALYGVEQSGREWGNEAADTLIQNGCRSETASP------GW 228 KV RALYG++QSGREWG EAAD LI+NG P GW Sbjct: 402 KVERALYGLKQSGREWGFEAADALIENGYEQGRVDPCLPEGGGW 445
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Match: A0A6H5K164_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K164_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 1.250e-5 Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 1 Query: 61 PGGAGSRSTCSAPQRLDTKVVRALYGVEQSGREWGNEAADTLIQNGCRSETASP 222 P G G +S R K RA+YG++QSGR+WG AADTL++NG A P Sbjct: 503 PAGCGDKS------RKTLKAERAIYGLKQSGRQWGYHAADTLVENGFEQCKADP 550 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig10995.889.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig10995.889.1 >prot_L-elsbetiae_contig10995.889.1 ID=prot_L-elsbetiae_contig10995.889.1|Name=mRNA_L-elsbetiae_contig10995.889.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=80bp MRSALLRWRSALKWKKQKQKPGGAGSRSTCSAPQRLDTKVVRALYGVEQSback to top mRNA from alignment at L-elsbetiae_contig10995:3074..4146- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig10995.889.1 ID=mRNA_L-elsbetiae_contig10995.889.1|Name=mRNA_L-elsbetiae_contig10995.889.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1073bp|location=Sequence derived from alignment at L-elsbetiae_contig10995:3074..4146- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig10995:3074..4146- >mRNA_L-elsbetiae_contig10995.889.1 ID=mRNA_L-elsbetiae_contig10995.889.1|Name=mRNA_L-elsbetiae_contig10995.889.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=480bp|location=Sequence derived from alignment at L-elsbetiae_contig10995:3074..4146- (Laminarionema elsbetiae ELsaHSoW15)back to top |