prot_L-elsbetiae_contig10904.824.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_L-elsbetiae_contig10904.824.1
Unique Name	prot_L-elsbetiae_contig10904.824.1
Type	polypeptide
Organism	Laminarionema elsbetiae ELsaHSoW15 (Laminarionema elsbetiae ELsaHSoW15)
Sequence length	169

Homology

[Close]

BLAST of mRNA_L-elsbetiae_contig10904.824.1 vs. uniprot
Match: D7G161_ECTSI (Alpha-1,3-glucosyltransferase n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G161_ECTSI)

HSP 1 Score: 134 bits (338), Expect = 1.270e-33
Identity = 88/182 (48.35%), Postives = 108/182 (59.34%), Query Frame = 0

Query:    1 MHLRLSFLAAFAALPLLPGPELKMLKVVLVTTNLALATSLLEYRHNSQSVVLGANLEPDHAPLLG------GGHLSPANPPTDTTSTAA---------LPRRVA-------------PPLPAAPWLLWTAWDRAYVAAAGVVWAFGELVHPWVFGPGTLPFLPLMAVSVFGAVGVVACWVLS 154
            M+LRLSFLAAFA  PLLPGPEL++LKVVL+ T+L LATSLLE+RH       G  + P H+ +            SP++ P + +  A+          P + A              P P     LWT WD+AYVA AGV++  GE+VHP VF  GTLPFLPLM VSVFGAVGV+ACW LS
Sbjct:  457 MYLRLSFLAAFAVFPLLPGPELRVLKVVLLITHLMLATSLLEHRHAENIKYEG--MAPTHSRVSERILADHSSERSPSSAPGEPSRKASGSVTELVGLAPEQRAGAGVGRVSTGGKCAPAPC----LWTGWDKAYVAGAGVIFVLGEVVHPLVFQEGTLPFLPLMGVSVFGAVGVMACWGLS 632

The following BLAST results are available for this feature:

BLAST of mRNA_L-elsbetiae_contig10904.824.1 vs. uniprot

BLAST of mRNA_L-elsbetiae_contig10904.824.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
D7G161_ECTSI	1.270e-33	48.35	Alpha-1,3-glucosyltransferase n=2 Tax=Ectocarpus T...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR004856	Glycosyl transferase, ALG6/ALG8	PFAM	PF03155	Alg6_Alg8	coord: 4..153 e-value: 1.2E-7 score: 31.1
IPR004856	Glycosyl transferase, ALG6/ALG8	PANTHER	PTHR12413	DOLICHYL GLYCOSYLTRANSFERASE	coord: 3..152
IPR039487	Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase	PANTHER	PTHR12413:SF2	DOLICHYL PYROPHOSPHATE GLC1MAN9GLCNAC2 ALPHA-1,3-GLUCOSYLTRANSFERASE-RELATED	coord: 3..152
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 19..105
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 159..168
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE	Signal Peptide	coord: 1..18
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 127..132
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 133..158
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_N_REGION	Signal peptide N-region	coord: 1..4
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_H_REGION	Signal peptide H-region	coord: 5..14
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_C_REGION	Signal peptide C-region	coord: 15..18
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 106..126
None	No IPR available	SIGNALP_EUK	SignalP-noTM	SignalP-noTM	coord: 1..18 score: 0.587
None	No IPR available	TMHMM	TMhelix		coord: 107..126
None	No IPR available	TMHMM	TMhelix		coord: 136..158

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
L-elsbetiae_contig10904	contig	L-elsbetiae_contig10904:3794..6350 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Laminarionema elsbetiae ELsaHSoW15	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_L-elsbetiae_contig10904.824.1	mRNA_L-elsbetiae_contig10904.824.1	Laminarionema elsbetiae ELsaHSoW15	mRNA	L-elsbetiae_contig10904 3649..6465 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_L-elsbetiae_contig10904.824.1 ID=prot_L-elsbetiae_contig10904.824.1|Name=mRNA_L-elsbetiae_contig10904.824.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=169bp
MHLRLSFLAAFAALPLLPGPELKMLKVVLVTTNLALATSLLEYRHNSQSV
VLGANLEPDHAPLLGGGHLSPANPPTDTTSTAALPRRVAPPLPAAPWLLW
TAWDRAYVAAAGVVWAFGELVHPWVFGPGTLPFLPLMAVSVFGAVGVVAC
WVLSAAGAPAAAPAPRPR*

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR004856	Glyco_trans_ALG6/ALG8
IPR039487	ALG8