mRNA_L-elsbetiae_contig2107.6386.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: A0A6H5L5J2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5J2_9PHAE) HSP 1 Score: 64.3 bits (155), Expect = 1.810e-10 Identity = 24/30 (80.00%), Postives = 28/30 (93.33%), Query Frame = 3 Query: 75 GGDPHFCLPGPPDEMALLLLKLVWAVHQER 164 G DPHFCLPGPPDE+ LLLLK++WA+HQER Sbjct: 185 GNDPHFCLPGPPDELGLLLLKIIWAIHQER 214
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: D7G974_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G974_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 1.870e-8 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 3 Query: 63 EKYVGGDPHFCLPGPPDEMALLLLKLVWAVHQER 164 E+ V DPHFC+PGPPDE+ +LLLKL+WA+H E+ Sbjct: 152 ERTVEDDPHFCMPGPPDEVGILLLKLLWALHHEK 185
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: A0A6H5KAG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAG2_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 4.070e-8 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 3 Query: 63 EKYVGGDPHFCLPGPPDEMALLLLKLVWAVHQER 164 E+ V DPHFC+PGPPDE+ +LLLKL+WA+H E+ Sbjct: 418 ERTVENDPHFCMPGPPDEVGILLLKLLWALHHEK 451
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: A0A6H5LBA5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LBA5_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 7.180e-8 Identity = 21/28 (75.00%), Postives = 26/28 (92.86%), Query Frame = 3 Query: 81 DPHFCLPGPPDEMALLLLKLVWAVHQER 164 DPHFCLPGPPDE+ LLLK++WA++QER Sbjct: 187 DPHFCLPGPPDELGFLLLKIIWALYQER 214 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig2107.6386.1 >prot_L-elsbetiae_contig2107.6386.1 ID=prot_L-elsbetiae_contig2107.6386.1|Name=mRNA_L-elsbetiae_contig2107.6386.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=53bp MESVGQDHENKVEDDRFEKYVGGDPHFCLPGPPDEMALLLLKLVWAVHQEback to top mRNA from alignment at L-elsbetiae_contig2107:11473..11751+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig2107.6386.1 ID=mRNA_L-elsbetiae_contig2107.6386.1|Name=mRNA_L-elsbetiae_contig2107.6386.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=279bp|location=Sequence derived from alignment at L-elsbetiae_contig2107:11473..11751+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig2107:11473..11751+ >mRNA_L-elsbetiae_contig2107.6386.1 ID=mRNA_L-elsbetiae_contig2107.6386.1|Name=mRNA_L-elsbetiae_contig2107.6386.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=318bp|location=Sequence derived from alignment at L-elsbetiae_contig2107:11473..11751+ (Laminarionema elsbetiae ELsaHSoW15)back to top |