mRNA_L-elsbetiae_contig2104.6379.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2104.6379.1 vs. uniprot
Match: D8LE06_ECTSI (Sel1 domain protein repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LE06_ECTSI) HSP 1 Score: 69.3 bits (168), Expect = 2.180e-10 Identity = 33/38 (86.84%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 943 GVAPLSDEAAAARDELRASLLEAKRVNDNLVAGYDYGL 1056 G +PLSDEAAAARDELRASLLEA+RVN LVAGYDYGL Sbjct: 135 GASPLSDEAAAARDELRASLLEAQRVNKELVAGYDYGL 172
BLAST of mRNA_L-elsbetiae_contig2104.6379.1 vs. uniprot
Match: A0A6U4KSW9_9STRA (Hypothetical protein n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A6U4KSW9_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 8.920e-8 Identity = 31/70 (44.29%), Postives = 47/70 (67.14%), Query Frame = 1 Query: 193 GLDYDLGKGLGLTRGHEVPISVVQSVIHAADQGNRDSLYFLGLLKLYGISVSPDAGKALEYMRKAAELRH 402 GLD LG+ +GL G ++ + V +VI A +G+ +SLYFLGL +LYG+ ++ D +AL+ R+AAE H Sbjct: 33 GLDVTLGEEVGLEPGDDIDPATVNAVIQGAGRGSPESLYFLGLFRLYGMGMAKDELRALQSFRRAAEAGH 102
BLAST of mRNA_L-elsbetiae_contig2104.6379.1 vs. uniprot
Match: A0A482SI98_9ARCH (Sel1 repeat family protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SI98_9ARCH) HSP 1 Score: 63.2 bits (152), Expect = 2.470e-7 Identity = 28/72 (38.89%), Postives = 46/72 (63.89%), Query Frame = 1 Query: 196 LDYDLGKGLGLTRGHEVPISVVQSVIHAADQGNRDSLYFLGLLKLYGISVSPDAGKALEYMRKAAELRHLEA 411 L+ LGK G+T+ + ++Q ++ + GN+D++YF GLLKLYGIS+ D+ A + +A++L H EA Sbjct: 29 LEIQLGKEKGITQDASISADILQRILAGVEAGNKDNIYFYGLLKLYGISMVKDSKSAAQQFLRASKLGHAEA 100 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2104.6379.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig2104.6379.1 >prot_L-elsbetiae_contig2104.6379.1 ID=prot_L-elsbetiae_contig2104.6379.1|Name=mRNA_L-elsbetiae_contig2104.6379.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=358bp MRTIARRHLCALVSTAATLGILGVVDCDVSGSYHGAAARSALHDAGEMDPback to top mRNA from alignment at L-elsbetiae_contig2104:4985..10214- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig2104.6379.1 ID=mRNA_L-elsbetiae_contig2104.6379.1|Name=mRNA_L-elsbetiae_contig2104.6379.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=5230bp|location=Sequence derived from alignment at L-elsbetiae_contig2104:4985..10214- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig2104:4985..10214- >mRNA_L-elsbetiae_contig2104.6379.1 ID=mRNA_L-elsbetiae_contig2104.6379.1|Name=mRNA_L-elsbetiae_contig2104.6379.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=2148bp|location=Sequence derived from alignment at L-elsbetiae_contig2104:4985..10214- (Laminarionema elsbetiae ELsaHSoW15)back to top |