prot_L-elsbetiae_contig20742.6256.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20742.6256.1 vs. uniprot
Match: D7G857_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G857_ECTSI) HSP 1 Score: 105 bits (263), Expect = 1.150e-25 Identity = 46/53 (86.79%), Postives = 48/53 (90.57%), Query Frame = 0 Query: 1 FPGCSHIIIADADWRPKLETVDKSELDFVHGSFPFLVWDHSGHTSRLVGWLLR 53 FP SHII+ADADWRP L TVDKSELDFVHGSFPFLVWDHSGHTSRL+GWL R Sbjct: 162 FPDTSHIIVADADWRPDLATVDKSELDFVHGSFPFLVWDHSGHTSRLMGWLHR 214
BLAST of mRNA_L-elsbetiae_contig20742.6256.1 vs. uniprot
Match: A0A482RZ88_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RZ88_9ARCH) HSP 1 Score: 61.2 bits (147), Expect = 4.770e-10 Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 0 Query: 1 FPGCSHIIIADADWRPKLETVDKSELDFVHGSFPFLVWDHSGHTSRLVGWLL 52 F SH++IAD DW+P +ET+DK+ELD F F+V+D SG T R + W L Sbjct: 100 FSKASHVMIADPDWKPSVETIDKAELDDSALVFRFMVFDRSGETRRYIDWCL 151 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20742.6256.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig20742.6256.1 ID=prot_L-elsbetiae_contig20742.6256.1|Name=mRNA_L-elsbetiae_contig20742.6256.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=53bpback to top |