prot_L-elsbetiae_contig2041.6148.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2041.6148.1 vs. uniprot
Match: A0A6H5JCE6_9PHAE (2OG-FeII_Oxy_3 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCE6_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 3.190e-9 Identity = 51/132 (38.64%), Postives = 63/132 (47.73%), Query Frame = 0 Query: 1 MGRSRICGVCYLA---LTVPVVTVTSWGGSGIYGGSTSXXXXXTRRCATRSVR---SGAWGVATQKRKRTGVPSSSSSSVLVPRRTSSSLKVSDAGVDIGLDSDLELGEGEELLGTIDVSPEEIAELFAKPT 126 M R + C+LA + P V SWG S ++S + C T S G W VA + RR S LK G D+G+ +ELGEGEELLGT+DVSPEE+AE FAKPT Sbjct: 1 MPRPSVRATCFLAAVSMNQPQ-GVISWGAS--LKAASSRHGAGSIPCTTSSTTCLGGGVWNVAAPSER---------------RRRLSRLKAGGVGSDVGVGXXMELGEGEELLGTVDVSPEEVAEFFAKPT 114 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2041.6148.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2041.6148.1 ID=prot_L-elsbetiae_contig2041.6148.1|Name=mRNA_L-elsbetiae_contig2041.6148.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=127bpback to top |