prot_L-elsbetiae_contig1967.5868.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1967.5868.1 vs. uniprot
Match: A0A6H5JA82_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JA82_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 8.700e-14 Identity = 47/64 (73.44%), Postives = 51/64 (79.69%), Query Frame = 0 Query: 2 AEPVLAGRKIVRQLMHVNGVEADELTLTELRASLLSEDALSLAQEGQEHDDTAAVSYVFCHVPI 65 A P+ AGRK+VRQLM VNGVEADELTL E AS+LSEDALSLAQEG DTAAVSY CHV + Sbjct: 1027 AMPMPAGRKMVRQLMFVNGVEADELTLAE--ASVLSEDALSLAQEG----DTAAVSYAVCHVSV 1084
BLAST of mRNA_L-elsbetiae_contig1967.5868.1 vs. uniprot
Match: D7FZC5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZC5_ECTSI) HSP 1 Score: 72.8 bits (177), Expect = 3.620e-11 Identity = 42/54 (77.78%), Postives = 45/54 (83.33%), Query Frame = 0 Query: 2 AEPVLAGRKIVRQLMHVNGVEADELTLTELRASLLSEDALSLAQEGQEHDDTAA 55 A P+ AGRK+VRQLM VNGVEADELTL EL AS+LSEDALSLAQEG DTAA Sbjct: 995 AMPMPAGRKMVRQLMFVNGVEADELTLAELHASVLSEDALSLAQEG----DTAA 1044 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1967.5868.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1967.5868.1 ID=prot_L-elsbetiae_contig1967.5868.1|Name=mRNA_L-elsbetiae_contig1967.5868.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=225bpback to top |