prot_L-elsbetiae_contig19648.5856.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19648.5856.1 vs. uniprot
Match: A0A6H5JSZ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSZ5_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 2.020e-8 Identity = 30/49 (61.22%), Postives = 34/49 (69.39%), Query Frame = 0 Query: 45 LAEH----KFRKGGLCQVLRGQGGVLVSSGVEGGYTPDGIMLCHMFMLR 89 +AEH F K + +GGVLVSSGVEGGYTPDG+M CHMFMLR Sbjct: 649 VAEHWGKTNFGKEDCAKFFVDRGGVLVSSGVEGGYTPDGVMTCHMFMLR 697
BLAST of mRNA_L-elsbetiae_contig19648.5856.1 vs. uniprot
Match: A0A6H5JJM9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJM9_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 2.040e-8 Identity = 30/49 (61.22%), Postives = 34/49 (69.39%), Query Frame = 0 Query: 45 LAEH----KFRKGGLCQVLRGQGGVLVSSGVEGGYTPDGIMLCHMFMLR 89 +AEH F K + +GGVLVSSGVEGGYTPDG+M CHMFMLR Sbjct: 836 VAEHWGKTNFGKEDCAKFFVDRGGVLVSSGVEGGYTPDGVMTCHMFMLR 884
BLAST of mRNA_L-elsbetiae_contig19648.5856.1 vs. uniprot
Match: A0A6H5KKU6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKU6_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 2.480e-7 Identity = 27/40 (67.50%), Postives = 30/40 (75.00%), Query Frame = 0 Query: 50 FRKGGLCQVLRGQGGVLVSSGVEGGYTPDGIMLCHMFMLR 89 F K + +GGVLVSSGVEGGYT DGIM+CHMFMLR Sbjct: 388 FGKEDCAKFFVDRGGVLVSSGVEGGYTADGIMMCHMFMLR 427
BLAST of mRNA_L-elsbetiae_contig19648.5856.1 vs. uniprot
Match: A0A6H5KMZ3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KMZ3_9PHAE) HSP 1 Score: 49.3 bits (116), Expect = 8.080e-5 Identity = 21/28 (75.00%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 62 QGGVLVSSGVEGGYTPDGIMLCHMFMLR 89 +G LVSSGVEGGY+PDG+ CHMFMLR Sbjct: 3 RGAWLVSSGVEGGYSPDGVQTCHMFMLR 30
BLAST of mRNA_L-elsbetiae_contig19648.5856.1 vs. uniprot
Match: A0A6H5JVZ9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVZ9_9PHAE) HSP 1 Score: 49.3 bits (116), Expect = 9.130e-5 Identity = 21/28 (75.00%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 62 QGGVLVSSGVEGGYTPDGIMLCHMFMLR 89 +G LVSSGVEGGY+PDG+ CHMFMLR Sbjct: 62 RGAWLVSSGVEGGYSPDGVQTCHMFMLR 89
BLAST of mRNA_L-elsbetiae_contig19648.5856.1 vs. uniprot
Match: A0A6H5K1E3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1E3_9PHAE) HSP 1 Score: 49.3 bits (116), Expect = 9.360e-5 Identity = 21/28 (75.00%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 62 QGGVLVSSGVEGGYTPDGIMLCHMFMLR 89 +G LVSSGVEGGY+PDG+ CHMFMLR Sbjct: 399 RGAWLVSSGVEGGYSPDGVQTCHMFMLR 426 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19648.5856.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19648.5856.1 ID=prot_L-elsbetiae_contig19648.5856.1|Name=mRNA_L-elsbetiae_contig19648.5856.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=89bpback to top |