mRNA_L-elsbetiae_contig19412.5760.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19412.5760.1 vs. uniprot
Match: A0A6H5KNG5_9PHAE (BEACH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KNG5_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 7.100e-9 Identity = 37/78 (47.44%), Postives = 43/78 (55.13%), Query Frame = 1 Query: 1 EACASIEEDRRALAFAHDVELRLNPWYGRPRTRV---VNESDFALPASSENAGI------------YLTSATWRGGFG 189 EA A +EEDRRA AFA DV LRL PWYGRPRTR + +D A AS AG+ +A RGG+G Sbjct: 757 EARAKVEEDRRAFAFARDVGLRLEPWYGRPRTRSGSGPSVADSAAAASGGTAGVTAPAGEDIATPTMTAAAARRGGYG 834
BLAST of mRNA_L-elsbetiae_contig19412.5760.1 vs. uniprot
Match: D8LHG8_ECTSI (BEACH domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHG8_ECTSI) HSP 1 Score: 61.6 bits (148), Expect = 9.680e-9 Identity = 27/33 (81.82%), Postives = 28/33 (84.85%), Query Frame = 1 Query: 1 EACASIEEDRRALAFAHDVELRLNPWYGRPRTR 99 EA A +EEDRRA AFAHDV LRL PWYGRPRTR Sbjct: 767 EARAKVEEDRRAFAFAHDVGLRLEPWYGRPRTR 799 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19412.5760.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig19412.5760.1 >prot_L-elsbetiae_contig19412.5760.1 ID=prot_L-elsbetiae_contig19412.5760.1|Name=mRNA_L-elsbetiae_contig19412.5760.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=110bp EACASIEEDRRALAFAHDVELRLNPWYGRPRTRVVNESDFALPASSENAGback to top mRNA from alignment at L-elsbetiae_contig19412:103..604- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig19412.5760.1 ID=mRNA_L-elsbetiae_contig19412.5760.1|Name=mRNA_L-elsbetiae_contig19412.5760.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=502bp|location=Sequence derived from alignment at L-elsbetiae_contig19412:103..604- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig19412:103..604- >mRNA_L-elsbetiae_contig19412.5760.1 ID=mRNA_L-elsbetiae_contig19412.5760.1|Name=mRNA_L-elsbetiae_contig19412.5760.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=660bp|location=Sequence derived from alignment at L-elsbetiae_contig19412:103..604- (Laminarionema elsbetiae ELsaHSoW15)back to top |