prot_L-elsbetiae_contig19195.5668.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19195.5668.1 vs. uniprot
Match: A0A6H5JXU8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXU8_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 1.350e-5 Identity = 38/131 (29.01%), Postives = 64/131 (48.85%), Query Frame = 0 Query: 22 YGSFKSSAPLATREDMEHRM---EAMMIGAGYSSVLAVHTHVVTEGLRGCDQDLLIELV--STEFTTKPVKMTVRISQGNTCVGPGGSRTFMSDKLTHCMHNIEYSFVDGEVTTVSRVLIPGRVPLSFAFP 147 YG + S+P D+ + + G G + VH VV GLRGCD+ ++++V + + P+ + +R T PG +S+ H F+DG +TTV+++ I GR+PL +A+P Sbjct: 10 YGDWPGSSPPERNTDLRDLLLWQHVFLAGLGMKT--HVHVAVVEAGLRGCDETCMMDVVFGTPKKEGDPLPILLRWEFCPTQNTPG----VVSEPTLAVWHETAPCFLDGVMTTVTKIAIRGRIPLEWAWP 134 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19195.5668.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19195.5668.1 ID=prot_L-elsbetiae_contig19195.5668.1|Name=mRNA_L-elsbetiae_contig19195.5668.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=245bpback to top |