mRNA_L-elsbetiae_contig19159.5655.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19159.5655.1 vs. uniprot
Match: A0A6H5JME6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JME6_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 3.730e-5 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = -2 Query: 363 LFAEGVTVRRSMIKVVLVGQEGAGKTR*ACVRFLLLLG 476 LF EGV+VRR+MIKVVLVGQEGAGKTR A + L LG Sbjct: 91 LFEEGVSVRRNMIKVVLVGQEGAGKTRSAYSQALXYLG 128 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19159.5655.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig19159.5655.1 >prot_L-elsbetiae_contig19159.5655.1 ID=prot_L-elsbetiae_contig19159.5655.1|Name=mRNA_L-elsbetiae_contig19159.5655.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=159bp GNKKSRKERDKVKAVSSMLGDKQKGGCISISSWQVAPFRKEGAPPPHLTAback to top mRNA from alignment at L-elsbetiae_contig19159:970..1448+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig19159.5655.1 ID=mRNA_L-elsbetiae_contig19159.5655.1|Name=mRNA_L-elsbetiae_contig19159.5655.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=479bp|location=Sequence derived from alignment at L-elsbetiae_contig19159:970..1448+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig19159:970..1448+ >mRNA_L-elsbetiae_contig19159.5655.1 ID=mRNA_L-elsbetiae_contig19159.5655.1|Name=mRNA_L-elsbetiae_contig19159.5655.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=954bp|location=Sequence derived from alignment at L-elsbetiae_contig19159:970..1448+ (Laminarionema elsbetiae ELsaHSoW15)back to top |