mRNA_L-elsbetiae_contig1907.5616.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1907.5616.1 vs. uniprot
Match: D7G1V0_ECTSI (DRG1, developmenally regulated GTPase 1 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G1V0_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 1.640e-9 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 2 Query: 338 QVTIEELDIICQIPHHVVVSAAHGWNIDEV 427 QVTIEELDIICQIPHHVVVSAAHGWNIDE+ Sbjct: 256 QVTIEELDIICQIPHHVVVSAAHGWNIDEL 285
BLAST of mRNA_L-elsbetiae_contig1907.5616.1 vs. uniprot
Match: A0A836CK18_9STRA (DRG1, developmenally regulated GTPase 1 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CK18_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 5.510e-7 Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = 2 Query: 338 QVTIEELDIICQIPHHVVVSAAHGWNIDEV 427 Q+TIEELDIICQIPHHVVVSA H WN+DE+ Sbjct: 255 QLTIEELDIICQIPHHVVVSAHHRWNLDEL 284
BLAST of mRNA_L-elsbetiae_contig1907.5616.1 vs. uniprot
Match: A0A482SMM1_9ARCH (GTP-binding protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SMM1_9ARCH) HSP 1 Score: 53.1 bits (126), Expect = 7.020e-5 Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 2 Query: 338 QVTIEELDIICQIPHHVVVSAAHGWNIDEV 427 Q+TIEELDII Q+PHHV +SA HGWN DE+ Sbjct: 259 QLTIEELDIIDQMPHHVPISAHHGWNFDEL 288 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1907.5616.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1907.5616.1 >prot_L-elsbetiae_contig1907.5616.1 ID=prot_L-elsbetiae_contig1907.5616.1|Name=mRNA_L-elsbetiae_contig1907.5616.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=199bp GARTGGAVGFGIVRGMLLSFDLGGPLLRVEQEKTAISRSVQFNAIHPGSDback to top mRNA from alignment at L-elsbetiae_contig1907:13238..13834+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1907.5616.1 ID=mRNA_L-elsbetiae_contig1907.5616.1|Name=mRNA_L-elsbetiae_contig1907.5616.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=597bp|location=Sequence derived from alignment at L-elsbetiae_contig1907:13238..13834+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1907:13238..13834+ >mRNA_L-elsbetiae_contig1907.5616.1 ID=mRNA_L-elsbetiae_contig1907.5616.1|Name=mRNA_L-elsbetiae_contig1907.5616.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1194bp|location=Sequence derived from alignment at L-elsbetiae_contig1907:13238..13834+ (Laminarionema elsbetiae ELsaHSoW15)back to top |