prot_L-elsbetiae_contig1897.5574.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1897.5574.1 vs. uniprot
Match: A0A6H5JPS6_9PHAE (Non-structural maintenance of chromosomes element 4 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPS6_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 2.130e-15 Identity = 35/47 (74.47%), Postives = 39/47 (82.98%), Query Frame = 0 Query: 1 MSFTKADFDELKELYNMEGSHIPHRNDGPRSDYYDPLRDGNRESNRQ 47 MSFT ADF ELKELY ME S+ HR++GP+SDYYDPL GNRESNRQ Sbjct: 67 MSFTPADFRELKELYGMEESNFEHRSEGPKSDYYDPLTHGNRESNRQ 113
BLAST of mRNA_L-elsbetiae_contig1897.5574.1 vs. uniprot
Match: D7G069_ECTSI (Non-structural maintenance of chromosomes element 4 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G069_ECTSI) HSP 1 Score: 72.8 bits (177), Expect = 8.810e-14 Identity = 35/47 (74.47%), Postives = 39/47 (82.98%), Query Frame = 0 Query: 1 MSFTKADFDELKELYNMEGSHIPHRNDGPRSDYYDPLRDGNRESNRQ 47 MSFT ADF ELKELY ME S+ HR++GP+SDYYDPL GNRESNRQ Sbjct: 399 MSFTPADFRELKELYGMEESNFEHRSEGPKSDYYDPLTHGNRESNRQ 445 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1897.5574.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1897.5574.1 ID=prot_L-elsbetiae_contig1897.5574.1|Name=mRNA_L-elsbetiae_contig1897.5574.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=48bpback to top |