prot_L-elsbetiae_contig1897.5573.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1897.5573.1 vs. uniprot
Match: D7G069_ECTSI (Non-structural maintenance of chromosomes element 4 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G069_ECTSI) HSP 1 Score: 94.0 bits (232), Expect = 8.140e-21 Identity = 51/69 (73.91%), Postives = 57/69 (82.61%), Query Frame = 0 Query: 9 KGKKVKQNKDQTQTRIANMKEAEKHSDSFNSNQDMFETFINPKSFTQTVENIFDFSFFVKSGEGHISID 77 KGKK KQNKDQTQ RIA M+E EK + S +DMFET +NPKSFTQTVEN+FDFSFFVK GEGHI+ID Sbjct: 301 KGKKAKQNKDQTQMRIAKMREHEK--EDAGSKKDMFETLVNPKSFTQTVENLFDFSFFVKRGEGHITID 367
BLAST of mRNA_L-elsbetiae_contig1897.5573.1 vs. uniprot
Match: A0A6H5JPS6_9PHAE (Non-structural maintenance of chromosomes element 4 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPS6_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 4.750e-13 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 43 MFETFINPKSFTQTVENIFDFSFFVKSGEGHISID 77 MFET INPKSFTQTVEN+FDFSFFVKSGEGHI+ID Sbjct: 1 MFETLINPKSFTQTVENLFDFSFFVKSGEGHITID 35
BLAST of mRNA_L-elsbetiae_contig1897.5573.1 vs. uniprot
Match: G5ADR1_PHYSP (Non-structural maintenance of chromosomes element 4 n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G5ADR1_PHYSP) HSP 1 Score: 48.1 bits (113), Expect = 5.920e-5 Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 41 QDMFETFINPKSFTQTVENIFDFSFFVKSGEGHISIDE 78 Q +F+ INPKSFTQTVEN+FD SF V++ + IDE Sbjct: 63 QPLFDVVINPKSFTQTVENLFDTSFLVRNSAAEVGIDE 100
BLAST of mRNA_L-elsbetiae_contig1897.5573.1 vs. uniprot
Match: A0A225VE20_9STRA (Non-structural maintenance of chromosomes element 4 (Fragment) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VE20_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 7.060e-5 Identity = 22/41 (53.66%), Postives = 28/41 (68.29%), Query Frame = 0 Query: 38 NSNQDMFETFINPKSFTQTVENIFDFSFFVKSGEGHISIDE 78 N +F+ INPKSFTQTVEN+FD SF V++ + IDE Sbjct: 49 NDRHSLFDMVINPKSFTQTVENLFDTSFLVRNSSAEVGIDE 89 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1897.5573.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1897.5573.1 ID=prot_L-elsbetiae_contig1897.5573.1|Name=mRNA_L-elsbetiae_contig1897.5573.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=78bpback to top |