prot_L-elsbetiae_contig1895.5567.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1895.5567.1 vs. uniprot
Match: A0A6H5JH57_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH57_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 1.110e-8 Identity = 29/38 (76.32%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 20 HLRNFAVSADERRQMEEDYRLALTMQRGGVAGAAGDRG 57 HLRNFAV+ADERRQMEEDYRLAL MQ+G A A G G Sbjct: 28 HLRNFAVTADERRQMEEDYRLALAMQKGEAAAANGTGG 65
BLAST of mRNA_L-elsbetiae_contig1895.5567.1 vs. uniprot
Match: D8LDG4_ECTSI (FYVE-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDG4_ECTSI) HSP 1 Score: 56.6 bits (135), Expect = 7.620e-8 Identity = 28/35 (80.00%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 20 HLRNFAVSADERRQMEEDYRLALTMQRGGVAGAAG 54 HLRNFAV+ADERRQMEEDYRLAL MQ+G A A G Sbjct: 378 HLRNFAVTADERRQMEEDYRLALAMQKGEAAVANG 412 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1895.5567.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1895.5567.1 ID=prot_L-elsbetiae_contig1895.5567.1|Name=mRNA_L-elsbetiae_contig1895.5567.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=60bpback to top |