mRNA_L-elsbetiae_contig18890.5548.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18890.5548.1 vs. uniprot
Match: A0A6H5KIS3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIS3_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 1.050e-8 Identity = 26/46 (56.52%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 13 IMFDCHAHLTDPYFREGIDEALAQAEDVGVVGIIAVSETSEDAVKV 150 +MFDCHAHLTD EG+ + L +AE GV GI+AVSE+ +DA V Sbjct: 45 VMFDCHAHLTDSSLAEGLHQTLLEAEAAGVTGIVAVSESLDDATPV 90
BLAST of mRNA_L-elsbetiae_contig18890.5548.1 vs. uniprot
Match: D7FNX7_ECTSI (TatD DNase domain containing 3 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNX7_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 1.580e-8 Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 1 Query: 16 MFDCHAHLTDPYFREGIDEALAQAEDVGVVGIIAVSETSEDAVKV 150 MFDCHAHLTD EG+ + L +AE GV GI+AVSE+ +DA V Sbjct: 1 MFDCHAHLTDSSLAEGLQQTLLEAEAAGVTGIVAVSESLDDATPV 45 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18890.5548.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig18890.5548.1 >prot_L-elsbetiae_contig18890.5548.1 ID=prot_L-elsbetiae_contig18890.5548.1|Name=mRNA_L-elsbetiae_contig18890.5548.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=54bp MFDCHAHLTDPYFREGIDEALAQAEDVGVVGIIAVSETSEDAVKVRRHLPback to top mRNA from alignment at L-elsbetiae_contig18890:1862..2038+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig18890.5548.1 ID=mRNA_L-elsbetiae_contig18890.5548.1|Name=mRNA_L-elsbetiae_contig18890.5548.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=177bp|location=Sequence derived from alignment at L-elsbetiae_contig18890:1862..2038+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig18890:1862..2038+ >mRNA_L-elsbetiae_contig18890.5548.1 ID=mRNA_L-elsbetiae_contig18890.5548.1|Name=mRNA_L-elsbetiae_contig18890.5548.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=324bp|location=Sequence derived from alignment at L-elsbetiae_contig18890:1862..2038+ (Laminarionema elsbetiae ELsaHSoW15)back to top |