prot_L-elsbetiae_contig18750.5488.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18750.5488.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 5
ZOOM
x 1
POSITION
0
VLLRAIRNKYLWLAVSLMFYTFGISGGVFDIIRKPPPFMLNKDGTFGWFHPQVR5101520253035404550Expect = 1.55e-18 / Id = 74.51Expect = 1.35e-10 / Id = 50.98Expect = 9.57e-10 / Id = 50.00Expect = 1.27e-8 / Id = 58.54Expect = 3.02e-8 / Id = 50.94SequenceD8LPZ2_ECTSIA0A485L545_9STRAA0A0P1AWF5_PLAHLA0A836CB15_9STRAA0A7S2UY50_9STRA
Match NameE-valueIdentityDescription
D8LPZ2_ECTSI1.550e-1874.51Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2... [more]
A0A485L545_9STRA1.350e-1050.98Aste57867_16045 protein n=1 Tax=Aphanomyces stella... [more]
A0A0P1AWF5_PLAHL9.570e-1050.00Magnesium transporter protein 1-like n=1 Tax=Plasm... [more]
A0A836CB15_9STRA1.270e-858.54Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
A0A7S2UY50_9STRA3.020e-850.94Hypothetical protein n=1 Tax=Fibrocapsa japonica T... [more]
back to top