mRNA_L-elsbetiae_contig1856.5408.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1856.5408.1 vs. uniprot
Match: B5LWB0_9PHYC (Uncharacterized protein n=1 Tax=Feldmannia species virus TaxID=39420 RepID=B5LWB0_9PHYC) HSP 1 Score: 89.4 bits (220), Expect = 4.900e-22 Identity = 42/63 (66.67%), Postives = 53/63 (84.13%), Query Frame = 1 Query: 16 GASGVSLLSGSGVVVGDSIVLVSGGRSWRIRLPSTKESAENVLVIEYRSGVVWRQAAIYIVPP 204 G +GVSLLSGSG+VVG+SI L SGGRSWR+RLPS+ ES +N+LV EY+SG W QAA++ +PP Sbjct: 7 GNTGVSLLSGSGIVVGESITLFSGGRSWRLRLPSSSESEDNILVFEYKSGARWVQAAVFAIPP 69
BLAST of mRNA_L-elsbetiae_contig1856.5408.1 vs. uniprot
Match: Q6XM23_9PHYC (FirrV-1-B13 n=1 Tax=Feldmannia irregularis virus a TaxID=231992 RepID=Q6XM23_9PHYC) HSP 1 Score: 81.3 bits (199), Expect = 7.390e-19 Identity = 44/68 (64.71%), Postives = 52/68 (76.47%), Query Frame = 1 Query: 1 MDGGS-GASGVSLLSGSGVVVGDSIVLVSGGRSWRIRLPSTKESAENVLVIEYRSGVVWRQAAIYIVP 201 MDG S G +GVSLLSGSG++V SI L SGGRSWR RLPS+ ES N+LV+EY+ G W QAA+Y VP Sbjct: 1 MDGTSTGTAGVSLLSGSGLLVESSITLYSGGRSWRFRLPSSSESENNILVVEYKLGAQWVQAAVYRVP 68
BLAST of mRNA_L-elsbetiae_contig1856.5408.1 vs. uniprot
Match: Q6XLU2_9PHYC (FirrV-1-I4 n=1 Tax=Feldmannia irregularis virus a TaxID=231992 RepID=Q6XLU2_9PHYC) HSP 1 Score: 76.3 bits (186), Expect = 7.080e-17 Identity = 38/61 (62.30%), Postives = 47/61 (77.05%), Query Frame = 1 Query: 16 GASGVSLLSGSGVVVGDSIVLVSGGRSWRIRLPSTKESAENVLVIEYRSGVVWRQAAIYIV 198 G +GVSLLSGS ++V SI L SGGRSWR RLPS+ ES +N+LV+EY+SG W QA +Y V Sbjct: 7 GTAGVSLLSGSRLLVESSITLFSGGRSWRFRLPSSSESEKNILVVEYKSGARWVQAGVYAV 67
BLAST of mRNA_L-elsbetiae_contig1856.5408.1 vs. uniprot
Match: Q8QNI2_ESV1K (EsV-1-95 n=2 Tax=root TaxID=1 RepID=Q8QNI2_ESV1K) HSP 1 Score: 61.6 bits (148), Expect = 4.440e-11 Identity = 31/67 (46.27%), Postives = 47/67 (70.15%), Query Frame = 1 Query: 1 MDGGSGAS-GVSLLSGSGVVVGDSIVLVSGGRSWRIRLPSTKESAENVLVIEYRSGVVWRQAAIYIV 198 M+GGS GV+L +G GDS+ LVSGGR WR+R+PS +ES++N+L++E + G+ W A ++V Sbjct: 1 MEGGSSNGFGVTLENGMSTTGGDSMTLVSGGRIWRLRVPSIQESSDNILILEVKHGITWYPAQQFVV 67 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1856.5408.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1856.5408.1 >prot_L-elsbetiae_contig1856.5408.1 ID=prot_L-elsbetiae_contig1856.5408.1|Name=mRNA_L-elsbetiae_contig1856.5408.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=70bp MDGGSGASGVSLLSGSGVVVGDSIVLVSGGRSWRIRLPSTKESAENVLVIback to top mRNA from alignment at L-elsbetiae_contig1856:11416..11625- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1856.5408.1 ID=mRNA_L-elsbetiae_contig1856.5408.1|Name=mRNA_L-elsbetiae_contig1856.5408.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=210bp|location=Sequence derived from alignment at L-elsbetiae_contig1856:11416..11625- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1856:11416..11625- >mRNA_L-elsbetiae_contig1856.5408.1 ID=mRNA_L-elsbetiae_contig1856.5408.1|Name=mRNA_L-elsbetiae_contig1856.5408.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=420bp|location=Sequence derived from alignment at L-elsbetiae_contig1856:11416..11625- (Laminarionema elsbetiae ELsaHSoW15)back to top |