mRNA_L-elsbetiae_contig18267.5286.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Match: D8LTJ4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTJ4_ECTSI) HSP 1 Score: 90.1 bits (222), Expect = 2.870e-20 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 1 Query: 1 VAADRNGNIFVGGQTDGNLFAPASAGDGQDIWVAKLDGAGGELLWGYQASA 153 VA DR+GNIFVGGQTDGNLFAP + GDGQDIWVAKL+G GG LLWGYQ + Sbjct: 82 VATDRSGNIFVGGQTDGNLFAPWTEGDGQDIWVAKLEGEGGGLLWGYQVGS 132
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Match: A0A6H5KWN4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWN4_9PHAE) HSP 1 Score: 90.1 bits (222), Expect = 8.300e-20 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 1 Query: 1 VAADRNGNIFVGGQTDGNLFAPASAGDGQDIWVAKLDGAGGELLWGYQASA 153 VA DR+GNIFVGGQTDGNLFAP + GDGQDIWVAKL+G GG LLWGYQ + Sbjct: 78 VATDRSGNIFVGGQTDGNLFAPWTEGDGQDIWVAKLEGEGGGLLWGYQVGS 128
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Match: A0A1Y0RJM2_9CYAN (Uncharacterized protein n=1 Tax=Nostocales cyanobacterium HT-58-2 TaxID=1940762 RepID=A0A1Y0RJM2_9CYAN) HSP 1 Score: 47.8 bits (112), Expect = 7.030e-5 Identity = 22/48 (45.83%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 1 VAADRNGNIFVGGQTDGNLFAPASAGDGQDIWVAKLDGAGGELLWGYQ 144 V D+ GN ++ G TDGNLF+ + D ++WVAK D + G+ LWG Q Sbjct: 283 VVTDKEGNFYLAGATDGNLFSSKQS-DELEVWVAKYD-SNGKQLWGKQ 328 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig18267.5286.1 >prot_L-elsbetiae_contig18267.5286.1 ID=prot_L-elsbetiae_contig18267.5286.1|Name=mRNA_L-elsbetiae_contig18267.5286.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=51bp VAADRNGNIFVGGQTDGNLFAPASAGDGQDIWVAKLDGAGGELLWGYQASback to top mRNA from alignment at L-elsbetiae_contig18267:2413..2565- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig18267.5286.1 ID=mRNA_L-elsbetiae_contig18267.5286.1|Name=mRNA_L-elsbetiae_contig18267.5286.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=153bp|location=Sequence derived from alignment at L-elsbetiae_contig18267:2413..2565- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig18267:2413..2565- >mRNA_L-elsbetiae_contig18267.5286.1 ID=mRNA_L-elsbetiae_contig18267.5286.1|Name=mRNA_L-elsbetiae_contig18267.5286.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=306bp|location=Sequence derived from alignment at L-elsbetiae_contig18267:2413..2565- (Laminarionema elsbetiae ELsaHSoW15)back to top |