mRNA_L-elsbetiae_contig18237.5274.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18237.5274.1 vs. uniprot
Match: D7FUJ6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUJ6_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 4.420e-8 Identity = 25/40 (62.50%), Postives = 28/40 (70.00%), Query Frame = -1 Query: 199 MVDNRSKSCGHPGCKKHPTYGVEGSKTMEFCAQRKKEGMV 318 MVD SK CGHPGC K P+YG +GSK E CAQ +GMV Sbjct: 1 MVDVVSKRCGHPGCTKRPSYGNDGSKKAELCAQHALQGMV 40
BLAST of mRNA_L-elsbetiae_contig18237.5274.1 vs. uniprot
Match: D7G985_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G985_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 9.250e-7 Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = -1 Query: 199 MVDNRSKSCGHPGCKKHPTYGVEGSKTMEFCAQRKKEGMV 318 M+D K CGH GC K P+YG +GSK EFCAQ ++GMV Sbjct: 1 MIDVVCKRCGHLGCMKRPSYGTDGSKKREFCAQHSQQGMV 40
BLAST of mRNA_L-elsbetiae_contig18237.5274.1 vs. uniprot
Match: D8LMB1_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMB1_ECTSI) HSP 1 Score: 51.6 bits (122), Expect = 4.870e-6 Identity = 21/39 (53.85%), Postives = 27/39 (69.23%), Query Frame = -1 Query: 202 MVDNRSKSCGHPGCKKHPTYGVEGSKTMEFCAQRKKEGM 318 MVD ++ C HPGC K P++G +GSK EFCAQ +GM Sbjct: 1 MVDVVNRRCRHPGCTKRPSFGQDGSKKQEFCAQHAHQGM 39
BLAST of mRNA_L-elsbetiae_contig18237.5274.1 vs. uniprot
Match: D8LCI2_ECTSI (EsV-1-7 n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LCI2_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 4.910e-6 Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = -1 Query: 196 CGHPGCKKHPTYGVEGSKTMEFCAQRKKEGMVD 294 CGHPGC KH +YGV+G+K EFC + K GMVD Sbjct: 6 CGHPGCGKHSSYGVKGTKEREFCGRHAKMGMVD 38
BLAST of mRNA_L-elsbetiae_contig18237.5274.1 vs. uniprot
Match: A0A6H5JV67_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV67_9PHAE) HSP 1 Score: 50.1 bits (118), Expect = 9.930e-5 Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = -1 Query: 199 KSCGHPGCKKHPTYGVEGSKTMEFCAQRKKEGMV 300 +SC GC K P+YG+EGSK E+CA+ KK+GMV Sbjct: 31 RSCQAKGCTKRPSYGMEGSKKQEYCAEHKKDGMV 64 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18237.5274.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig18237.5274.1 >prot_L-elsbetiae_contig18237.5274.1 ID=prot_L-elsbetiae_contig18237.5274.1|Name=mRNA_L-elsbetiae_contig18237.5274.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=114bp TPGEGPSSLPPGTGLADLRLYVHLTTSTMHGCSPSPPSCVERRTPSSSCCback to top mRNA from alignment at L-elsbetiae_contig18237:459..802+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig18237.5274.1 ID=mRNA_L-elsbetiae_contig18237.5274.1|Name=mRNA_L-elsbetiae_contig18237.5274.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=344bp|location=Sequence derived from alignment at L-elsbetiae_contig18237:459..802+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig18237:459..802+ >mRNA_L-elsbetiae_contig18237.5274.1 ID=mRNA_L-elsbetiae_contig18237.5274.1|Name=mRNA_L-elsbetiae_contig18237.5274.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=684bp|location=Sequence derived from alignment at L-elsbetiae_contig18237:459..802+ (Laminarionema elsbetiae ELsaHSoW15)back to top |