prot_L-elsbetiae_contig9593.18566.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9593.18566.1 vs. uniprot
Match: A0A6H5JHZ8_9PHAE (RING-type domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHZ8_9PHAE) HSP 1 Score: 145 bits (365), Expect = 3.470e-39 Identity = 70/94 (74.47%), Postives = 79/94 (84.04%), Query Frame = 0 Query: 55 MTTPVYVLKPVSSGYKEVLLPPGTRFVGRSAATGIKSPVVSRKHVEVAVERGRCKVRYCAKYVSEVKLNETPVKKEWVEFPVGGRLTLLTNVAE 148 MTTP+YVLKP+SSGYKEVLLPPGT+F+GRS ATGI+S VVSRKH+EVAVE CKVRYCAK+ SEVK++ VKKEWV FPVGGRL L N E Sbjct: 1 MTTPLYVLKPISSGYKEVLLPPGTKFIGRSVATGIQSQVVSRKHIEVAVEGDVCKVRYCAKFKSEVKIDNALVKKEWVPFPVGGRLEFLENPVE 94 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9593.18566.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9593.18566.1 ID=prot_L-elsbetiae_contig9593.18566.1|Name=mRNA_L-elsbetiae_contig9593.18566.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=216bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|