prot_L-elsbetiae_contig9495.18477.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9495.18477.1 vs. uniprot
Match: A0A6H5KXK5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXK5_9PHAE) HSP 1 Score: 82.4 bits (202), Expect = 2.510e-16 Identity = 47/71 (66.20%), Postives = 55/71 (77.46%), Query Frame = 0 Query: 1 EVLTSGQWAELLKAPLERAAAKGSRDLAQRLVRVGAQTGYALHAAVRRGHVDIVSDLVDSGASLVAKDTLG 71 E+LTS Q AELL+A LE AAAKG++DLAQRLVR GA+ G ALH AV GH +IVSDL++S ASL A D G Sbjct: 7 EILTSQQLAELLRALLEHAAAKGNKDLAQRLVRAGAEIGDALHRAVDGGHREIVSDLLESEASLAATDMDG 77
BLAST of mRNA_L-elsbetiae_contig9495.18477.1 vs. uniprot
Match: D8LL12_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LL12_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 6.670e-14 Identity = 39/71 (54.93%), Postives = 53/71 (74.65%), Query Frame = 0 Query: 1 EVLTSGQWAELLKAPLERAAAKGSRDLAQRLVRVGAQTGYALHAAVRRGHVDIVSDLVDSGASLVAKDTLG 71 EVLT+ WAE+L+ PLE AAA+G+ L Q+L+R GA G ALHAAVR GH ++V++L++ GA + KDT G Sbjct: 39 EVLTTHGWAEMLQFPLECAAAQGNVALTQKLLRAGADMGSALHAAVRYGHAEVVTNLLEHGACVSIKDTRG 109
BLAST of mRNA_L-elsbetiae_contig9495.18477.1 vs. uniprot
Match: D7FYD0_ECTSI (Ankyrin repeat protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FYD0_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 1.070e-7 Identity = 32/68 (47.06%), Postives = 43/68 (63.24%), Query Frame = 0 Query: 4 TSGQWAELLKAPLERAAAKGSRDLAQRLVRVGAQTGYALHAAVRRGHVDIVSDLVDSGASLVAKDTLG 71 T +WA LK PLE A G RDLA LVR GA+ G A++ A+ G +++S L+D+GAS+ A D G Sbjct: 25 TPEEWAAWLKVPLEIAVRTGDRDLASMLVRGGAEAGTAVNEAIACGDTEVMSLLLDNGASVSATDAEG 92 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9495.18477.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9495.18477.1 ID=prot_L-elsbetiae_contig9495.18477.1|Name=mRNA_L-elsbetiae_contig9495.18477.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=102bpback to top |